7NZD: Fourth SH3 domain of POSH

Fourth SH3 domain of POSH (Plenty of SH3 Domains protein). Determined by X-ray diffraction at 1.45 Å resolution. Released 22 Dec 2021.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 633
Mol. weight: 7.41 kDa
Released: 22 Dec 2021

Explore 7NZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NZD contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	832-836	5	1
β-strand	840	1	2
β-strand	847	1	1
α-helix	848-849	2
β-strand	850	1	2
β-strand	855-861	7	1
β-strand	866-871	6	1
β-strand	877-881	5	1
α-helix	882-884	3
β-strand	885-887	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase SH3RF1	AAA	protein	63	Homo sapiens	Q7Z6J0 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>7NZD_1 E3 ubiquitin-protein ligase SH3RF1 (chains AAA)
GRRVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFV
ENI

Primary citation

Visualizing protein breathing motions associated with aromatic ring flipping. Marino Perez, L., Ielasi, F.S., Bessa, L.M. et al. Nature (2022) 602:695-700. DOI 10.1038/s41586-022-04417-6 · PubMed

Other PDB entries of the same protein (UniProt Q7Z6J0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NZC 1.11 Å, First SH3 domain of POSH (Plenty of SH3 Domains protein)
9RFF 1.25 Å, Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
9TJY 1.77 Å, Crystal Structure of the Human Oncogenic Splice Variant Rac1b Fused with the Scaffold…
9RFB 1.85 Å, Crystal Structure of Human Rac1 in Complex with the Scaffold Protein POSH (residues…

Browse structure collections

About this viewer

MolViewer shows 7NZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.