7OHI: FCHO1-peptide-AP2 alpha ear complex

Name: PDB 7OHI: FCHO1-peptide-AP2 alpha ear complex
Published: 2022-06-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

FCHO1-peptide-AP2 alpha ear complex. Determined by X-ray diffraction at 1.41 Å resolution. Released 1 Jun 2022.

Method: X-ray diffraction
Resolution: 1.41 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,343
Mol. weight: 31.33 kDa
Released: 1 Jun 2022

Explore 7OHI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OHI contains 10 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	695-699	5
β-strand	700	1	1
α-helix	701-702	2
α-helix	705-708	4
β-strand	714-718	5	2
β-strand	722-731	10	2
β-strand	734-743	10	2
β-strand	749-757	9	1
α-helix	760-765	6
β-strand	766-770	5	2
β-strand	777	1	1
β-strand	782-791	10	2
β-strand	800-807	8	1
β-strand	810-817	8	1
α-helix	822-825	4
β-strand	826-828	3	3
α-helix	833-842	10
α-helix	846-848	3
β-strand	849-855	7	3
α-helix	862-872	11
β-strand	875-876	2	3
β-strand	887-894	8	3
β-strand	899-909	11	3
β-strand	914-921	8	3
α-helix	924-934	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	308-314	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit alpha-2	A	protein	250	Mus musculus	P17427 (AlphaFold model)
F-BAR domain only protein 1	B	protein	23	Homo sapiens	O14526 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OHI_1 AP-2 complex subunit alpha-2 (chains A)
GSPGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQ
FLNFTPTLICADDLQTNLNLQTKPVKPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYG
GTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAK
IIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQ
RLCELLSEQF

Sequence of entity 2 (B), FASTA

>7OHI_2 F-BAR domain only protein 1 (chains B)
QSEEQVSKNLFGPPLESAFDHED

Primary citation

FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch. Zaccai, N.R., Kadlecova, Z., Dickson, V.K. et al. Sci Adv (2022) 8:eabn2018-eabn2018. DOI 10.1126/sciadv.abn2018 · PubMed

Other PDB entries of the same protein (UniProt P17427 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYF 1.22 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1QTS 1.4 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
1QTP 1.6 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
2VJ0 1.6 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
1KYU 1.8 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1B9K 1.9 Å, Alpha-adaptin appendage domain, from clathrin adaptor AP2
1W80 1.9 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
3HS8 1.9 Å, Intersectin 1-peptide-AP2 alpha ear complex
9PUE 1.91 Å, Structure of Alpha Appendage of AP2 bound to the FxDxF motif derived of CCDC32
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
9PPP 2.1 Å, Structure of Alpha Appendage of AP2 bound to the extended FxDxF motif derived of CCDC32

Browse structure collections

About this viewer

MolViewer shows 7OHI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.