7OKP: Mouse CARM1

Crystal structure of mouse CARM1 in complex with histone H3_13-22 K18 acetylated. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Oct 2021.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Mus musculus, Homo sapiens
Chains: 8
Atoms: 12,181
Mol. weight: 174.12 kDa
Ligands: QVR, MLI
Released: 27 Oct 2021

Explore 7OKP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OKP contains 72 α-helices and 88 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-153	10
α-helix	157-164	8
α-helix	167-178	12
α-helix	181-183	3
β-strand	188-192	5	1
α-helix	198-205	8
β-strand	210-215	6	1
α-helix	219-229	11
β-strand	236-240	5	1
β-strand	252-257	6	1
β-strand	261	1	2
β-strand	264	1	2
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	1
β-strand	290-298	9	3
α-helix	301-311	11
α-helix	312-314	3
β-strand	319	1	4
β-strand	322	1	4
α-helix	325-327	3
α-helix	328-336	9
α-helix	339	1
β-strand	340-342	3	3
α-helix	346-348	3
β-strand	349	1	3
β-strand	354-359	6	3
α-helix	365-368	4
β-strand	370-378	9	5
α-helix	379	1
β-strand	383-397	15	3
β-strand	402-406	5	3
β-strand	418-429	12	3
β-strand	434-443	10	5
β-strand	449-457	9	5
β-strand	463-469	7	5
β-strand	474-475	2	3
α-helix	481-485	5

Chain B: 18 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-153	10
α-helix	157-165	9
α-helix	167-179	13
α-helix	181-183	3
β-strand	185	1	6
β-strand	188-192	5	7
α-helix	198-205	8
β-strand	208	1	6
β-strand	210-215	6	7
α-helix	219-229	11
β-strand	236-240	5	7
β-strand	252-257	6	7
β-strand	261	1	8
β-strand	264	1	8
α-helix	266-268	3
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	7
β-strand	290-298	9	9
α-helix	301-311	11
α-helix	312-315	4
β-strand	319	1	10
β-strand	322	1	10
α-helix	325-327	3
α-helix	328-336	9
α-helix	339	1
β-strand	340-342	3	9
α-helix	346-348	3
β-strand	349	1	9
α-helix	352-353	2
β-strand	354-359	6	9
α-helix	365-368	4
β-strand	370-378	9	11
β-strand	383-397	15	9
β-strand	402-406	5	9
β-strand	418-429	12	9
β-strand	434-443	10	11
β-strand	449-457	9	11
β-strand	462-469	8	11
β-strand	474-475	2	9

Chain C: 19 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	137-141	5
α-helix	144-154	11
α-helix	157-165	9
α-helix	167-179	13
α-helix	181-183	3
β-strand	188-192	5	12
α-helix	198-206	9
β-strand	210-215	6	12
α-helix	219-229	11
β-strand	236-240	5	12
β-strand	252-257	6	12
β-strand	261	1	13
β-strand	264	1	13
α-helix	266-268	3
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	12
β-strand	290-298	9	14
α-helix	301-311	11
α-helix	312-314	3
β-strand	319	1	15
β-strand	322	1	15
α-helix	325-327	3
α-helix	328-336	9
α-helix	339	1
β-strand	340-342	3	14
α-helix	346-348	3
β-strand	349	1	14
β-strand	354-359	6	14
α-helix	365-368	4
β-strand	370-378	9	16
β-strand	383-397	15	14
β-strand	402-406	5	14
β-strand	418-429	12	14
β-strand	431	1	17
β-strand	433	1	17
β-strand	434-443	10	16
β-strand	449-457	9	16
β-strand	463-469	7	16
β-strand	474-475	2	14
α-helix	481-485	5
α-helix	493-495	3

Chain D: 16 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	137-140	4
α-helix	144-153	10
α-helix	157-165	9
α-helix	167-178	12
α-helix	181-183	3
β-strand	188-192	5	18
α-helix	198-205	8
β-strand	210-215	6	18
α-helix	219-230	12
β-strand	236-240	5	18
β-strand	252-257	6	18
β-strand	261	1	19
β-strand	264	1	19
α-helix	269-275	7
α-helix	276-279	4
β-strand	280-287	8	18
β-strand	290-298	9	20
α-helix	301-311	11
α-helix	312-315	4
β-strand	319	1	21
β-strand	322	1	21
α-helix	325-327	3
α-helix	328-337	10
β-strand	340-342	3	20
α-helix	346-348	3
β-strand	349	1	20
α-helix	352-353	2
β-strand	354-359	6	20
α-helix	365-368	4
β-strand	370-378	9	22
β-strand	383-397	15	20
β-strand	402-406	5	20
β-strand	418-429	12	20
β-strand	434-443	10	22
β-strand	449-457	9	22
β-strand	462-469	8	22
β-strand	474-475	2	20

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	18-19	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-arginine methyltransferase CARM1	A, B, C, D	protein	371	Mus musculus	Q9WVG6 (AlphaFold model)
Histone H3.3	E, F, G, H	protein	11	Homo sapiens	P84243 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7OKP_1 Histone-arginine methyltransferase CARM1 (chains A, B, C, D)
GHMGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKD
KIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEV
SLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYME
QFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEG
DLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSP
LFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPP
GSHYTSPSENM

Sequence of entity 2 (E, F, G, H), FASTA

>7OKP_2 Histone H3.3 (chains E, F, G, H)
XGKAPRKQLAT

Ligands and cofactors

ID	Name	Formula	Copies
QVR	(2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3…	C12 H15 N5 O3	4
MLI	Malonate ion	C3 H2 O4	5

Primary citation

Structural Studies Provide New Insights into the Role of Lysine Acetylation on Substrate Recognition by CARM1 and Inform the Design of Potent Peptidomimetic Inhibitors. Zhang, Y., Marechal, N., van Haren, M.J. et al. Chembiochem (2021) 22:3469-3476. DOI 10.1002/cbic.202100506 · PubMed

Other PDB entries of the same protein (UniProt Q9WVG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IH3 1.77 Å, Crystal structure of mouse CARM1 in complex with SAH at 1.8 Angstroms resolution
5LV3 1.8 Å, Crystal structure of mouse CARM1 in complex with ligand LH1561Br
7QPH 1.9 Å, Crystal structure of mouse CARM1 in complex with histone H3_22-31 K27 acetylated
5K8X 1.99 Å, Crystal structure of mouse CARM1 in complex with inhibitor U3
5ISB 2.0 Å, Crystal structure of mouse CARM1 in complex with inhibitor SA0435
5LGR 2.0 Å, Crystal structure of mouse CARM1 in complex with ligand P1C3u
7QRD 2.0 Å, Crystal structure of mouse CARM1 in complex with histone H3_10-25
5IS6 2.01 Å, Crystal structure of mouse CARM1 in complex with Sinefungin at 2.0 Angstroms resolution
5LGP 2.04 Å, Crystal structure of mouse CARM1 in complex with ligand P1C3s
7PUQ 2.09 Å, CARM1 in complex with EML982
5ISE 2.1 Å, Crystal structure of mouse CARM1 in complex with inhibitor SA0649
5K8W 2.1 Å, Crystal structure of mouse CARM1 in complex with inhibitor U2

Browse structure collections

About this viewer

MolViewer shows 7OKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.