7OKQ: DDB1-DCAF1-CUL4A-RBX1 Complex

Name: PDB 7OKQ: Cryo-EM Structure of the DDB1-DCAF1-CUL4A-RBX1 Complex
Published: 2021-10-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Cryo-EM Structure of the DDB1-DCAF1-CUL4A-RBX1 Complex. Determined by electron microscopy at 8.4 Å resolution. Released 13 Oct 2021.

Method: Electron microscopy
Resolution: 8.4 Å
Organism: Homo sapiens
Chains: 16
Atoms: 44,608
Mol. weight: 1603.5 kDa
Released: 13 Oct 2021

Explore 7OKQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OKQ contains 248 α-helices and 604 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 102 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	18-21	4	2
β-strand	30-35	6	2
β-strand	38-45	8	2
β-strand	48-56	9	2
β-strand	61-67	7	3
β-strand	76-81	6	3
β-strand	85-94	10	3
β-strand	97-107	11	3
β-strand	115	1	4
β-strand	121-124	4	4
β-strand	130-136	7	4
β-strand	139-144	6	4
β-strand	155-158	4	4
β-strand	164-169	6	5
β-strand	171	1	6
β-strand	177-184	8	5
β-strand	187-196	10	5
β-strand	201-203	3	5
β-strand	210-211	2	5
β-strand	218-221	4	7
β-strand	228	1	6
β-strand	229-232	4	7
β-strand	237-241	5	7
β-strand	244-248	5	7
α-helix	251-254	4
β-strand	258-263	6	8
β-strand	270-275	6	8
β-strand	279-289	11	8
β-strand	295-307	13	8
β-strand	313-316	4	9
β-strand	321-325	5	9
β-strand	331-336	6	9
β-strand	347-353	7	9
β-strand	359-365	7	10
β-strand	372	1	11
β-strand	374-379	6	10
α-helix	382-384	3
β-strand	386-391	6	10
β-strand	394	1	12
β-strand	396-402	7	13
β-strand	407-413	7	14
β-strand	424-429	6	14
β-strand	433-439	7	14
β-strand	442-445	4	14
β-strand	457-463	7	15
β-strand	467-472	6	15
β-strand	476-480	5	15
β-strand	485-490	6	15
β-strand	500-504	5	16
β-strand	507-512	6	16
β-strand	515-522	8	16
β-strand	525-533	9	16
β-strand	538-542	5	17
β-strand	555-560	6	17
β-strand	565-570	6	17
β-strand	575-581	7	17
β-strand	588-596	9	18
β-strand	597	1	19
β-strand	599-606	8	18
β-strand	610-617	8	18
β-strand	622-630	9	18
β-strand	637-642	6	19
β-strand	647-652	6	19
β-strand	657-661	5	19
β-strand	666-670	5	19
β-strand	671	1	12
β-strand	678-682	5	13
β-strand	690-694	5	13
β-strand	699-704	6	13
β-strand	711-716	6	10
β-strand	720-727	8	20
β-strand	732-743	12	20
α-helix	744	1
β-strand	749-751	3	20
β-strand	762-765	4	20
β-strand	785-795	11	20
β-strand	801-806	6	20
α-helix	807-808	2
β-strand	811-820	10	21
β-strand	827-835	9	21
β-strand	845-854	10	21
β-strand	857-867	11	21
β-strand	870-876	7	22
β-strand	879-884	6	22
β-strand	887-893	7	22
β-strand	899-905	7	22
β-strand	914-917	4	23
β-strand	920-925	6	23
β-strand	929-936	8	23
β-strand	941-947	7	23
β-strand	954-958	5	24
β-strand	964-969	6	24
β-strand	973-979	7	24
α-helix	986-989	4
β-strand	991	1	23
β-strand	992-999	8	24
β-strand	1004-1009	6	1
β-strand	1014	1	11
β-strand	1024-1032	9	1
β-strand	1037-1043	7	1
α-helix	1045-1061	17
α-helix	1065-1067	3
α-helix	1070-1074	5
β-strand	1076-1077	2	25
β-strand	1082-1083	2	25
β-strand	1086	1	24
β-strand	1088-1090	3	1
α-helix	1091-1099	9
α-helix	1102-1109	8
β-strand	1113-1115	3	26
β-strand	1121-1123	3	26
α-helix	1126-1139	14

Chains B, F, J and N: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	1050-1055	6
α-helix	1056-1058	3
α-helix	1061-1063	3
α-helix	1069-1076	8
β-strand	1081-1086	6	27
β-strand	1095	1	27
β-strand	1096-1101	6	28
β-strand	1107-1112	6	28
β-strand	1116-1121	6	28
β-strand	1127-1132	6	28
β-strand	1138-1143	6	29
β-strand	1149-1154	6	29
β-strand	1161-1165	5	29
β-strand	1172-1176	5	29
β-strand	1181-1184	4	30
β-strand	1191-1196	6	30
β-strand	1199-1204	6	30
β-strand	1209-1214	6	30
β-strand	1229-1230	2	31
β-strand	1236-1239	4	31
β-strand	1242-1245	4	31
β-strand	1251-1254	4	31
β-strand	1265-1266	2	32
β-strand	1272-1275	4	32
β-strand	1278-1281	4	32
β-strand	1287-1290	4	32
α-helix	1292-1294	3
β-strand	1297	1	33
β-strand	1300-1301	2	34
β-strand	1307-1313	7	34
β-strand	1330-1338	9	34
β-strand	1343-1348	6	34
β-strand	1353-1358	6	27
β-strand	1365-1371	7	27
β-strand	1382-1388	7	27

Chains C, G, K and O: 44 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	44	1
β-strand	45-46	2	14
α-helix	56-73	18
α-helix	74-76	3
α-helix	83-93	11
α-helix	100-116	17
α-helix	119-121	3
α-helix	130-152	23
α-helix	154-156	3
α-helix	157-161	5
α-helix	170-177	8
α-helix	178-183	6
α-helix	186-204	19
α-helix	211-223	13
α-helix	227-231	5
α-helix	232-250	19
α-helix	260-276	17
α-helix	280-282	3
α-helix	283-291	9
α-helix	292-296	5
α-helix	299-302	4
α-helix	303-307	5
α-helix	308-312	5
α-helix	316-325	10
α-helix	335-352	18
α-helix	355-357	3
α-helix	358-378	21
α-helix	384-398	15
α-helix	404-416	13
β-strand	418	1	35
α-helix	426-438	13
α-helix	439-442	4
α-helix	447-462	16
β-strand	466	1	35
α-helix	469-480	12
α-helix	485-488	4
α-helix	489-512	24
α-helix	513-515	3
β-strand	522-529	8	36
α-helix	534-535	2
α-helix	545-558	14
β-strand	566-569	4	36
β-strand	575-582	8	36
β-strand	585-592	8	36
α-helix	593-600	8
β-strand	608-609	2	37
α-helix	610-617	8
α-helix	621-631	11
β-strand	639-641	3	37
β-strand	653-656	4	37
β-strand	667-668	2	36
α-helix	671-673	3
α-helix	678-698	21
β-strand	709-711	3	38
α-helix	712-722	11
α-helix	729-741	13
β-strand	745-747	3	38
β-strand	754-757	4	38

Chains D, H, L and P: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	22-34	13	36
β-strand	42	1	39
β-strand	46	1	39
α-helix	65-67	3
β-strand	70-72	3	40
β-strand	78-80	3	40
α-helix	81-85	5

Chain E: 11 helices, 102 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	41
β-strand	18-21	4	42
β-strand	30-35	6	42
β-strand	38-45	8	42
β-strand	48-56	9	42
β-strand	61-67	7	43
β-strand	76-81	6	43
β-strand	85-94	10	43
β-strand	97-107	11	43
β-strand	115	1	44
β-strand	121-124	4	44
β-strand	130-136	7	44
β-strand	139-144	6	44
β-strand	155-158	4	44
β-strand	164-169	6	45
β-strand	171	1	46
β-strand	177-184	8	45
β-strand	187-196	10	45
β-strand	201-203	3	45
β-strand	210-211	2	45
β-strand	218-221	4	47
β-strand	228	1	46
β-strand	229-232	4	47
β-strand	237-241	5	47
β-strand	244-248	5	47
α-helix	251-254	4
β-strand	258-263	6	48
β-strand	270-275	6	48
β-strand	279-289	11	48
β-strand	295-307	13	48
β-strand	313-316	4	49
β-strand	321-325	5	49
β-strand	331-336	6	49
β-strand	347-353	7	49
β-strand	359-365	7	50
β-strand	372	1	51
β-strand	374-379	6	50
α-helix	382-384	3
β-strand	386-392	7	50
β-strand	394	1	52
β-strand	396-402	7	53
β-strand	407-413	7	54
β-strand	424-429	6	54
β-strand	433-439	7	54
β-strand	442-445	4	54
β-strand	457-463	7	55
β-strand	467-472	6	55
β-strand	476-480	5	55
β-strand	485-490	6	55
β-strand	500-504	5	56
β-strand	507-512	6	56
β-strand	515-522	8	56
β-strand	525-533	9	56
β-strand	538-542	5	57
β-strand	555-560	6	57
β-strand	565-570	6	57
β-strand	575-581	7	57
β-strand	588-596	9	58
β-strand	597	1	59
β-strand	599-606	8	58
β-strand	610-617	8	58
β-strand	622-630	9	58
β-strand	637-642	6	59
β-strand	647-652	6	59
β-strand	657-661	5	59
β-strand	666-670	5	59
β-strand	671	1	52
β-strand	678-682	5	53
β-strand	690-694	5	53
β-strand	699-704	6	53
β-strand	710-716	7	50
β-strand	720-727	8	60
β-strand	732-743	12	60
β-strand	749-751	3	60
β-strand	763-765	3	60
β-strand	785-795	11	60
β-strand	801-806	6	60
β-strand	811-820	10	61
β-strand	827-835	9	61
β-strand	845-854	10	61
β-strand	857-867	11	61
β-strand	870-876	7	62
β-strand	879-884	6	62
β-strand	887-893	7	62
β-strand	899-905	7	62
β-strand	913-917	5	63
β-strand	920-924	5	63
β-strand	930-936	7	63
β-strand	941-947	7	63
β-strand	954-961	8	64
β-strand	964-969	6	64
β-strand	973-979	7	64
α-helix	986-989	4
β-strand	991	1	63
β-strand	992-999	8	64
β-strand	1004-1009	6	41
β-strand	1014	1	51
β-strand	1024-1032	9	41
β-strand	1037-1043	7	41
α-helix	1045-1061	17
α-helix	1063-1064	2
α-helix	1065-1067	3
α-helix	1070-1073	4
β-strand	1076-1077	2	65
β-strand	1082-1083	2	65
β-strand	1086	1	64
β-strand	1088-1090	3	41
α-helix	1091-1095	5
α-helix	1096-1099	4
α-helix	1102-1108	7
β-strand	1114-1115	2	66
β-strand	1121-1122	2	66
α-helix	1126-1137	12

Chain I: 11 helices, 102 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	81
β-strand	18-21	4	82
β-strand	30-35	6	82
β-strand	38-45	8	82
β-strand	48-56	9	82
β-strand	61-67	7	83
β-strand	76-81	6	83
β-strand	85-94	10	83
β-strand	97-107	11	83
β-strand	115	1	84
β-strand	121-124	4	84
β-strand	130-136	7	84
β-strand	139-144	6	84
β-strand	155-158	4	84
β-strand	164-169	6	85
β-strand	171	1	86
β-strand	177-184	8	85
β-strand	187-196	10	85
β-strand	201-203	3	85
β-strand	210-211	2	85
β-strand	218-221	4	87
β-strand	228	1	86
β-strand	229-232	4	87
β-strand	237-241	5	87
β-strand	244-248	5	87
α-helix	251-254	4
β-strand	258-263	6	88
β-strand	270-275	6	88
β-strand	279-289	11	88
β-strand	295-307	13	88
β-strand	313-316	4	89
β-strand	321-325	5	89
β-strand	331-336	6	89
β-strand	347-353	7	89
β-strand	359-365	7	90
β-strand	372	1	91
β-strand	374-379	6	90
α-helix	382-384	3
β-strand	386-392	7	90
β-strand	394	1	92
β-strand	396-402	7	93
β-strand	407-413	7	94
β-strand	424-429	6	94
β-strand	433-439	7	94
β-strand	442-445	4	94
β-strand	457-463	7	95
β-strand	467-472	6	95
β-strand	476-480	5	95
β-strand	485-490	6	95
β-strand	500-504	5	96
β-strand	507-512	6	96
β-strand	515-522	8	96
β-strand	525-533	9	96
β-strand	538-542	5	97
β-strand	555-560	6	97
β-strand	565-570	6	97
β-strand	575-581	7	97
β-strand	588-596	9	98
β-strand	597	1	99
β-strand	599-606	8	98
β-strand	610-617	8	98
β-strand	622-630	9	98
β-strand	637-642	6	99
β-strand	647-652	6	99
β-strand	657-661	5	99
β-strand	666-670	5	99
β-strand	671	1	92
β-strand	678-682	5	93
β-strand	690-694	5	93
β-strand	699-704	6	93
β-strand	710-716	7	90
β-strand	720-727	8	100
β-strand	732-743	12	100
β-strand	749-751	3	100
β-strand	763-765	3	100
β-strand	785-795	11	100
β-strand	801-806	6	100
β-strand	811-820	10	101
β-strand	827-835	9	101
β-strand	845-854	10	101
β-strand	857-867	11	101
β-strand	870-876	7	102
β-strand	879-884	6	102
β-strand	887-893	7	102
β-strand	899-905	7	102
β-strand	913-917	5	103
β-strand	920-924	5	103
β-strand	930-936	7	103
β-strand	941-947	7	103
β-strand	954-961	8	104
β-strand	964-969	6	104
β-strand	973-979	7	104
α-helix	986-989	4
β-strand	991	1	103
β-strand	992-999	8	104
β-strand	1004-1009	6	81
β-strand	1014	1	91
β-strand	1024-1032	9	81
β-strand	1037-1043	7	81
α-helix	1045-1061	17
α-helix	1063-1064	2
α-helix	1065-1067	3
α-helix	1070-1073	4
β-strand	1076-1077	2	105
β-strand	1082-1083	2	105
β-strand	1086	1	104
β-strand	1088-1090	3	81
α-helix	1091-1095	5
α-helix	1096-1099	4
α-helix	1102-1108	7
β-strand	1113-1115	3	106
β-strand	1121-1123	3	106
α-helix	1128-1137	10

Chain M: 11 helices, 102 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	121
β-strand	18-21	4	122
β-strand	30-35	6	122
β-strand	38-45	8	122
β-strand	48-56	9	122
β-strand	61-67	7	123
β-strand	76-81	6	123
β-strand	85-94	10	123
β-strand	97-107	11	123
β-strand	115	1	124
β-strand	121-124	4	124
β-strand	130-136	7	124
β-strand	139-144	6	124
β-strand	155-158	4	124
β-strand	164-169	6	125
β-strand	171	1	126
β-strand	177-184	8	125
β-strand	187-196	10	125
β-strand	201-203	3	125
β-strand	210-211	2	125
β-strand	218-221	4	127
β-strand	228	1	126
β-strand	229-232	4	127
β-strand	237-241	5	127
β-strand	244-248	5	127
α-helix	251-254	4
β-strand	258-263	6	128
β-strand	270-275	6	128
β-strand	279-289	11	128
β-strand	295-307	13	128
β-strand	313-316	4	129
β-strand	321-325	5	129
β-strand	331-336	6	129
β-strand	347-353	7	129
β-strand	359-365	7	130
β-strand	372	1	131
β-strand	374-379	6	130
α-helix	382-384	3
β-strand	386-392	7	130
β-strand	394	1	132
β-strand	396-402	7	133
β-strand	407-413	7	134
β-strand	424-429	6	134
β-strand	433-439	7	134
β-strand	442-445	4	134
β-strand	457-463	7	135
β-strand	467-472	6	135
β-strand	476-480	5	135
β-strand	485-490	6	135
β-strand	500-504	5	136
β-strand	507-512	6	136
β-strand	515-522	8	136
β-strand	525-533	9	136
β-strand	538-542	5	137
β-strand	555-560	6	137
β-strand	565-570	6	137
β-strand	575-581	7	137
β-strand	588-596	9	138
β-strand	597	1	139
β-strand	599-606	8	138
β-strand	610-617	8	138
β-strand	622-630	9	138
β-strand	637-642	6	139
β-strand	647-652	6	139
β-strand	657-661	5	139
β-strand	666-670	5	139
β-strand	671	1	132
β-strand	678-682	5	133
β-strand	690-694	5	133
β-strand	699-704	6	133
β-strand	710-716	7	130
β-strand	720-727	8	140
β-strand	732-743	12	140
β-strand	749-751	3	140
β-strand	763-765	3	140
β-strand	785-795	11	140
β-strand	801-806	6	140
β-strand	811-820	10	141
β-strand	827-835	9	141
β-strand	845-854	10	141
β-strand	857-867	11	141
β-strand	870-876	7	142
β-strand	879-884	6	142
β-strand	887-893	7	142
β-strand	899-905	7	142
β-strand	913-917	5	143
β-strand	920-924	5	143
β-strand	930-936	7	143
β-strand	941-947	7	143
β-strand	954-961	8	144
β-strand	964-969	6	144
β-strand	973-979	7	144
α-helix	986-989	4
β-strand	991	1	143
β-strand	992-999	8	144
β-strand	1004-1009	6	121
β-strand	1014	1	131
β-strand	1024-1032	9	121
β-strand	1037-1043	7	121
α-helix	1045-1061	17
α-helix	1063-1064	2
α-helix	1065-1067	3
α-helix	1070-1073	4
β-strand	1076-1077	2	145
β-strand	1082-1083	2	145
β-strand	1086	1	144
β-strand	1088-1090	3	121
α-helix	1091-1095	5
α-helix	1096-1099	4
α-helix	1102-1108	7
β-strand	1113-1115	3	146
β-strand	1121-1123	3	146
α-helix	1126-1137	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA damage-binding protein 1	A, E, I, M	protein	1159	Homo sapiens	Q16531 (AlphaFold model)
DDB1- and CUL4-associated factor 1	B, F, J, N	protein	1525	Homo sapiens	Q9Y4B6 (AlphaFold model)
Cullin-4A	C, G, K, O	protein	742	Homo sapiens	Q13619 (AlphaFold model)
E3 ubiquitin-protein ligase RBX1	D, H, L, P	protein	116	Homo sapiens	P62877 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>7OKQ_1 DNA damage-binding protein 1 (chains A, E, I, M)
MHHHHHHVDENLYFQGGGRMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEI
YVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDII
TRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEE
LHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIA
VPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLF
MLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSN
EQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHAS
IDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCG
NVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQI
HPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEM
LGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTF
RSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTI
GTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQAL
SSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKL
GKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLL
ASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGN
FEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLG
EFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKV
IKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMK
REATADDLIKVVEELTRIH

Sequence of entity 2 (B, F, J, N), FASTA

>7OKQ_2 DDB1- and CUL4-associated factor 1 (chains B, F, J, N)
MASWSHPQFEKLEVLFQGPTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLI
EKETEEYRKGDPDPFDDRHPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLN
TAACRLLLDIMPGLETAVVFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAA
NYRDENSQLVAIVLRRLRELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMA
VDVVDGDQEEASGDMEISFHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRKAK
QKLGFSSSDPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQE
LLPIFMQLGSRELMMFYIDLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLE
IPRPSMAATGVSMCLYYLSYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATM
FFSICFSFRAVLELFDRYDGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCM
ALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQ
LYWEPAEVFLKLSCVQLLLQLISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAE
SVDVLDEAGSTVSTVGISIILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIGKF
ISGTPRRKLPQNPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKAL
VGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLL
IGTDVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAAS
HSSAFTPVTAAASPVSLPRTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLAL
PGPSYAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQLDRHLPSPP
TLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRRQAPINFTSRLNRRASFPK
YGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNV
FSGQEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYV
EFSKHSQDRVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGV
LWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFN
HTGTVMYGAMLQADDEDDLMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTK
DCYLAVIENQGSMDALNMDTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTD
DLDELDTDQLLEAELEEDDNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEV
ELILGDTDSSDNSDLEDDIILSLNE

Sequence of entity 3 (C, G, K, O), FASTA

>7OKQ_3 Cullin-4A (chains C, G, K, O)
MHHHHHHVDEENLYFQGGGRGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSST
SIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINT
CWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGIL
LLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVP
EYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVP
DLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIE
VCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIM
ILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKD
MELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAF
YLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMAT
GIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKET
VEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIE
SLIDRDYMERDKDNPNQYHYVA

Sequence of entity 4 (D, H, L, P), FASTA

>7OKQ_4 E3 ubiquitin-protein ligase RBX1 (chains D, H, L, P)
MHHHHHHVDENLYFQGGGRGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDL
CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Primary citation

The CRL4 DCAF1 cullin-RING ubiquitin ligase is activated following a switch in oligomerization state. Mohamed, W.I., Schenk, A.D., Kempf, G. et al. EMBO J (2021) 40:e108008-e108008. DOI 10.15252/embj.2021108008 · PubMed

Other PDB entries of the same protein (UniProt Q16531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BBG 1.7 Å, Co-crystal structure of human DDB1 bound to fragment UB028671
9EJQ 1.87 Å, Crystal structure of DDB1 in complex with XS381952
9BBI 1.9 Å, Co-crystal structure of human DDB1 bound to fragment UB028669
9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
9BBE 2.0 Å, Co-crystal structure of human DDB1 bound to fragment UB028668
9BBH 2.0 Å, Co-crystal structure of human DDB1 bound to fragment UB028670
9FJX 2.0 Å, Crystal structure of human CRBN-DDB1 in complex with Lenalidomide
9ZXN 2.07 Å, DDB1 delta with compound 26
37MF 2.1 Å, Crystal structure of DDB1 in complex with XS445479
9ZXM 2.19 Å, DDB1 delta with compound 6
8G46 2.2 Å, Cryo-EM structure of DDB1deltaB-DDA1-DCAF16-BRD4(BD2)-MMH2
8ZSW 2.25 Å, Crystal Structure of Human DDB1, a Component of the E3 Ubiquitin Ligase Complex

Browse structure collections

About this viewer

MolViewer shows 7OKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.