7OM8: Beta2 appendage domain of AP2

Beta2 appendage domain of AP2 bound to terminal domains beneath the hub of the 28 triskelia mini clathrin coat complex, class 15. Determined by electron microscopy at 10.5 Å resolution. Released 11 Aug 2021.

Method: Electron microscopy
Resolution: 10.5 Å
Organisms: Sus scrofa, Homo sapiens
Chains: 3
Atoms: 4,254
Mol. weight: 93.5 kDa
Released: 11 Aug 2021

Explore 7OM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OM8 contains 15 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	709-711	3
β-strand	712-715	4	7
β-strand	723-732	10	7
β-strand	735-744	10	7
β-strand	750	1	8
β-strand	754-757	4	9
β-strand	760	1	10
β-strand	765-766	2	7
β-strand	776	1	8
β-strand	781-789	9	7
β-strand	794	1	10
β-strand	802-808	7	9
β-strand	813-819	7	9
α-helix	820-821	2
α-helix	822-825	4
β-strand	826	1	11
α-helix	831-833	3
α-helix	834-843	10
α-helix	846-848	3
β-strand	850-854	5	12
α-helix	861-869	9
β-strand	874-881	8	12
β-strand	884-892	9	12
β-strand	893	1	11
β-strand	898-905	8	12
β-strand	912-918	7	12
α-helix	921-923	3
α-helix	924-936	13

Chain Y: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	152-158	7	1
β-strand	164-171	8	1
α-helix	173-175	3
β-strand	178-185	8	1
β-strand	191-194	4	1
β-strand	198-204	7	2
β-strand	213-220	8	2
β-strand	227-230	4	2
β-strand	232	1	2
α-helix	240-245	6
β-strand	246-249	4	2
α-helix	250-251	2
β-strand	261-267	7	3
β-strand	272-277	6	3
β-strand	282-286	5	3
β-strand	292-296	5	3

Chain Z: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	108-112	5	4
β-strand	119-123	5	4
β-strand	126-130	5	4
β-strand	139-143	5	4
α-helix	144-145	2
β-strand	152-158	7	5
β-strand	164-171	8	5
α-helix	173-175	3
β-strand	178-185	8	5
β-strand	190-193	4	5
β-strand	198-204	7	6
β-strand	213-220	8	6
β-strand	227-230	4	6
β-strand	232	1	6
α-helix	243-245	3
β-strand	246-249	4	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain	Y, Z	protein	299	Sus scrofa	I3LGD4
AP-2 complex subunit beta	B	protein	233	Homo sapiens	P63010 (AlphaFold model)

Sequence of entity 1 (Y, Z), FASTA

>7OM8_1 Clathrin heavy chain (chains Y, Z)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRIS

Sequence of entity 2 (B), FASTA

>7OM8_2 AP-2 complex subunit beta (chains B)
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGV
IPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNV
LFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQ
DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

Primary citation

Multi-modal adaptor-clathrin contacts drive coated vesicle assembly. Smith, S.M., Larocque, G., Wood, K.M. et al. EMBO J (2021) 40:e108795-e108795. DOI 10.15252/embj.2021108795 · PubMed

Other PDB entries of the same protein (UniProt I3LGD4), best resolution first:

6YAI 9.2 Å, Clathrin with bound beta2 appendage of AP2

Browse structure collections

About this viewer

MolViewer shows 7OM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.