Mechanosensitive channel MscS solubilized with DDM in closed conformation. Determined by electron microscopy at 3.9 Å resolution. Released 1 Sept 2021.
Explore 7ONL in 3D Show helices and sheets RCSB PDB PDBe
7ONL contains 56 α-helices and 67 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-58 | 36 | |
| α-helix | 63-89 | 27 | |
| α-helix | 94-127 | 34 | |
| β-strand | 135-138 | 4 | 1 |
| β-strand | 141-148 | 8 | 1 |
| β-strand | 152-156 | 5 | 1 |
| β-strand | 162-166 | 5 | 1 |
| α-helix | 167-171 | 5 | |
| β-strand | 175-177 | 3 | 1 |
| β-strand | 183-192 | 10 | 2 |
| α-helix | 198-211 | 14 | |
| β-strand | 222-228 | 7 | 2 |
| β-strand | 233-242 | 10 | 2 |
| α-helix | 243-245 | 3 | |
| α-helix | 246-264 | 19 | |
| α-helix | 268-270 | 3 | |
| β-strand | 272-276 | 5 | 3 |
| β-strand | 278 | 1 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-58 | 36 | |
| α-helix | 63-89 | 27 | |
| α-helix | 94-127 | 34 | |
| β-strand | 135-138 | 4 | 1 |
| β-strand | 141-148 | 8 | 1 |
| β-strand | 152-156 | 5 | 1 |
| β-strand | 162-166 | 5 | 1 |
| α-helix | 167-171 | 5 | |
| β-strand | 175-177 | 3 | 1 |
| β-strand | 183-192 | 10 | 5 |
| α-helix | 198-211 | 14 | |
| β-strand | 222-228 | 7 | 5 |
| β-strand | 233-242 | 10 | 5 |
| α-helix | 243-245 | 3 | |
| α-helix | 246-264 | 19 | |
| α-helix | 268-270 | 3 | |
| β-strand | 272-273 | 2 | 3 |
| β-strand | 274-278 | 5 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-58 | 36 | |
| α-helix | 63-89 | 27 | |
| α-helix | 94-127 | 34 | |
| β-strand | 135-138 | 4 | 1 |
| β-strand | 141-148 | 8 | 1 |
| β-strand | 152-156 | 5 | 1 |
| β-strand | 162-166 | 5 | 1 |
| α-helix | 167-171 | 5 | |
| β-strand | 175-177 | 3 | 1 |
| β-strand | 183-192 | 10 | 6 |
| α-helix | 198-211 | 14 | |
| β-strand | 222-228 | 7 | 6 |
| β-strand | 233-242 | 10 | 6 |
| α-helix | 243-245 | 3 | |
| α-helix | 246-264 | 19 | |
| α-helix | 268-270 | 3 | |
| β-strand | 272-278 | 7 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small-conductance mechanosensitive channel | A, B, C, D, E, F, G | protein | 294 | Escherichia coli (strain K12) | P0C0S1 (AlphaFold model) |
>7ONL_1 Small-conductance mechanosensitive channel (chains A, B, C, D, E, F, G) MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAALEHHHHHH
Mechanosensitive channel gating by delipidation. Flegler, V.J., Rasmussen, A., Borbil, K. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2107095118 · PubMed
Other PDB entries of the same protein (UniProt P0C0S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ONL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.