7OO6: Mechanosensitive channel of small conductance

Mechanosensitive channel MscS solubilized with DDM in closed conformation with added lipid. Determined by electron microscopy at 3.1 Å resolution. Released 1 Sept 2021.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Escherichia coli
Chains: 7
Atoms: 14,546
Mol. weight: 233.04 kDa
Ligands: LMT, PCW
Released: 1 Sept 2021

Explore 7OO6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OO6 contains 49 α-helices and 70 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F and G: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	23-58	36
α-helix	63-89	27
α-helix	94-110	17
α-helix	112-127	16
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-171	5
β-strand	175-177	3	1
β-strand	183-192	10	2
α-helix	198-211	14
β-strand	215	1	2
β-strand	222-228	7	2
β-strand	233-242	10	2
α-helix	246-264	19
β-strand	272-278	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mechanosensitive channel of small conductance (MscS)	A, B, C, D, E, F, G	protein	294	Escherichia coli	P0C0S1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>7OO6_1 Mechanosensitive channel of small conductance (MscS) (chains A, B, C, D, E, F, G)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
LMT	Dodecyl-beta-D-maltoside	C24 H46 O11	7
PCW	1,2-dioleoyl-sn-glycero-3-phosphocholine	C44 H85 N O8 P	7

Primary citation

Mechanosensitive channel gating by delipidation. Flegler, V.J., Rasmussen, A., Borbil, K. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2107095118 · PubMed

Other PDB entries of the same protein (UniProt P0C0S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ONJ 2.3 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation
9E68 2.5 Å, Cryo-EM structure of MscS/YnaI chimera in DOPC nanodiscs
7OOA 2.7 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation with added lipid
9H2S 2.7 Å, a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids…
9H2V 2.8 Å, a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets
6RLD 2.9 Å, Structure of the mechanosensitive channel mscs embedded in the membrane bilayer
5AJI 2.99 Å, MscS D67R1 high resolution
6PWN 3.1 Å, MscS Nanodisc with N-terminal His-Tag
7OO0 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in open conformation
8DDJ 3.1 Å, Open MscS in PC14.1 Nanodiscs
6VYK 3.2 Å, Cryo-EM structure of mechanosensitive channel MscS in PC-18:1 nanodiscs
6UZH 3.3 Å, Cryo-EM structure of mechanosensitive channel MscS reconstituted into peptidiscs

Browse structure collections

About this viewer

MolViewer shows 7OO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.