Structure of human DPP3 in complex with a hydroxyethylene transition state peptidomimetic. Determined by X-ray diffraction at 2.65 Å resolution. Released 11 Aug 2021.
Explore 7OUP in 3D Show helices and sheets RCSB PDB PDBe
7OUP contains 41 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| β-strand | 14-16 | 3 | 1 |
| α-helix | 20-25 | 6 | |
| α-helix | 28-45 | 18 | |
| α-helix | 47-50 | 4 | |
| α-helix | 56-69 | 14 | |
| α-helix | 72-81 | 10 | |
| α-helix | 86-102 | 17 | |
| β-strand | 106 | 1 | 2 |
| β-strand | 112 | 1 | 3 |
| β-strand | 113 | 1 | 2 |
| α-helix | 120-128 | 9 | |
| α-helix | 131-135 | 5 | |
| α-helix | 137-152 | 16 | |
| α-helix | 156-158 | 3 | |
| β-strand | 160 | 1 | 3 |
| β-strand | 161 | 1 | 4 |
| β-strand | 168 | 1 | 4 |
| β-strand | 172 | 1 | 5 |
| α-helix | 178-191 | 14 | |
| β-strand | 198-204 | 7 | 5 |
| α-helix | 209 | 1 | |
| β-strand | 210-217 | 8 | 5 |
| α-helix | 229-232 | 4 | |
| β-strand | 236-239 | 4 | 5 |
| β-strand | 242-250 | 9 | 5 |
| α-helix | 252-266 | 15 | |
| α-helix | 272-287 | 16 | |
| α-helix | 290-302 | 13 | |
| β-strand | 308-316 | 9 | 6 |
| β-strand | 327-335 | 9 | 6 |
| α-helix | 337-348 | 12 | |
| α-helix | 350-354 | 5 | |
| α-helix | 361-363 | 3 | |
| β-strand | 372-382 | 11 | 6 |
| β-strand | 389-392 | 4 | 6 |
| α-helix | 396-401 | 6 | |
| β-strand | 405-409 | 5 | 6 |
| α-helix | 410-417 | 8 | |
| α-helix | 429-448 | 20 | |
| α-helix | 449-455 | 7 | |
| β-strand | 462 | 1 | 7 |
| β-strand | 477 | 1 | 8 |
| β-strand | 484 | 1 | 8 |
| α-helix | 485 | 1 | |
| β-strand | 489 | 1 | 7 |
| α-helix | 495-499 | 5 | |
| α-helix | 500-502 | 3 | |
| α-helix | 503-518 | 16 | |
| α-helix | 522-527 | 6 | |
| α-helix | 532-552 | 21 | |
| α-helix | 553-556 | 4 | |
| β-strand | 557-558 | 2 | 9 |
| β-strand | 563-564 | 2 | 9 |
| α-helix | 567-581 | 15 | |
| β-strand | 587-593 | 7 | 10 |
| β-strand | 599-605 | 7 | 10 |
| α-helix | 609 | 1 | |
| α-helix | 610-614 | 5 | |
| α-helix | 615-630 | 16 | |
| α-helix | 634-644 | 11 | |
| α-helix | 655-664 | 10 | |
| α-helix | 668-670 | 3 | |
| β-strand | 671-673 | 3 | 1 |
| β-strand | 676-680 | 5 | 11 |
| β-strand | 683-687 | 5 | 11 |
| α-helix | 693-701 | 9 | |
| α-helix | 708-721 | 14 | |
| α-helix | 723-725 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dipeptidyl peptidase 3 | A | protein | 737 | Homo sapiens | Q9NY33 (AlphaFold model) |
| ((2R,4S,5S)-5-((S)-2-amino-3-methylbutanamido)-2-benzyl-4-hydroxy-6-methylheptanoyl)-L-prolyl-L-try… | F | protein | 4 | synthetic construct |
>7OUP_1 Dipeptidyl peptidase 3 (chains A) MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIY ALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPK EKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMED AKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFR GSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFW IQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWP PTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQ REKLTFLEEDDKDLYILWKGPSFDVQVGLHALLGHGSGKLFVQDEKGAFNFDQETVINPE TGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIY VNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPD ARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRD TVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLAT ADARFWKGPSEAPSGQA
>7OUP_2 ((2R,4S,5S)-5-((S)-2-amino-3-methylbutanamido)-2-benzyl-4-hydroxy-6-methylheptanoyl)-L-prolyl-L-tryptophan (chains F) VXPW
Water and common crystallization additives (K) are not listed.
Efficient Entropy-Driven Inhibition of Dipeptidyl Peptidase III by Hydroxyethylene Transition-State Peptidomimetics. Ivkovic, J., Jha, S., Lembacher-Fadum, C. et al. Chemistry (2021) 27:14108-14120. DOI 10.1002/chem.202102204 · PubMed
Other PDB entries of the same protein (UniProt Q9NY33 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7OUP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.