7OVI: Protein kinase MKK7

Protein kinase MKK7 in complex with phenethyltriazole-substituted pyrazolopyrimidine. Determined by X-ray diffraction at 1.95 Å resolution. Released 20 Jul 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,178
Mol. weight: 36.59 kDa
Ligands: 2GI
Released: 20 Jul 2022

Explore 7OVI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OVI contains 17 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	121-124	4	1
β-strand	127-130	4	1
α-helix	133-135	3
β-strand	136-141	6	2
β-strand	150-155	6	2
β-strand	161-168	8	2
α-helix	173-187	15
β-strand	195	1	3
α-helix	196-197	2
β-strand	198-203	6	2
β-strand	207-212	6	2
α-helix	213-215	3
β-strand	217-218	2	3
α-helix	219-226	8
α-helix	229-231	3
α-helix	232-253	22
α-helix	262-264	3
β-strand	265-267	3	3
β-strand	273-275	3	3
α-helix	319-333	15
α-helix	344-353	10
α-helix	355-356	2
α-helix	358-360	3
α-helix	367-376	10
α-helix	385-386	2
α-helix	387-390	4
α-helix	394-401	8
α-helix	406-414	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity mitogen-activated protein kinase kinase 7	A	protein	318	Homo sapiens	O14733 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7OVI_1 Dual specificity mitogen-activated protein kinase kinase 7 (chains A)
MGHHHHHHSAKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQ
MRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRM
QGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVD
SKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFE
VLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDV
ASWFKDVMAKTESPRTSG

Ligands and cofactors

ID	Name	Formula	Copies
2GI	1-[(3~{R})-3-[4-azanyl-3-[1-(2-phenylethyl)-1,2,3-triazol-4-yl]pyrazolo[3,4-d]p…	C23 H27 N9 O	1

Primary citation

Optimization of Covalent MKK7 Inhibitors via Crude Nanomole-Scale Libraries. Gehrtz, P., Marom, S., Buhrmann, M. et al. J Med Chem (2022) 65:10341-10356. DOI 10.1021/acs.jmedchem.1c02206 · PubMed

Other PDB entries of the same protein (UniProt O14733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y90 1.3 Å, MAP2K7 mutant -C218S
6YZ4 1.7 Å, Crystal structure of MKK7 (MAP2K7) with ibrutinib bound at allosteric site
6YFZ 1.9 Å, Crystal structure of MKK7 (MAP2K7), apo form
6YG0 2.0 Å, Crystal structure of S287D,T291D MKK7 (MAP2K7), apo form
6YG2 2.0 Å, Crystal structure of MKK7 (MAP2K7) in complex with ibrutnib, with covalent and…
6YG3 2.05 Å, Crystal structure of MKK7 (MAP2K7) covalently bound with CPT1-70-1
7OVK 2.05 Å, Protein kinase MKK7 in complex with 5-bromo-2-hydroxyphenyl-substituted pyrazolopyrimidine
7CBX 2.06 Å, Crystal structure of MAP2K7 complexed with a covalent inhibitor 12
5B2L 2.1 Å, A crucial role of Cys218 in the stabilization of an unprecedented auto-inhibition form…
6IB2 2.1 Å, The structure of MKK7 in complex with the covalent 4-amino-pyrazolopyrimidine 4a
6QG7 2.1 Å, Structure of the mitogen activated kinase kinase 7 in complex with pyrazolopyrimidine 1k
6YG6 2.15 Å, Crystal structure of MKK7 (MAP2K7) covalently bound with type-II inhibitor TL10-105

Browse structure collections

About this viewer

MolViewer shows 7OVI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.