7OWM: HsNMT1

HsNMT1 in complex with both MyrCoA and HCPA substrate peptide GKQNSKLR. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Dec 2022.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,658
Mol. weight: 96.19 kDa
Ligands: MYA
Released: 21 Dec 2022

Explore 7OWM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OWM contains 36 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	109-113	5
α-helix	120-122	3
β-strand	136	1	1
α-helix	140-142	3
α-helix	149-153	5
β-strand	156-160	5	2
α-helix	166-179	14
β-strand	182	1	3
β-strand	188-190	3	3
α-helix	194-201	8
α-helix	208-210	3
β-strand	211-216	6	2
β-strand	222-235	14	2
β-strand	238-250	13	2
α-helix	252-254	3
α-helix	259-272	14
β-strand	279-283	5	2
β-strand	292-294	3	2
β-strand	296-300	5	4
α-helix	303-308	6
α-helix	320-326	7
β-strand	338-340	3	4
α-helix	343-345	3
α-helix	346-357	12
β-strand	362-365	4	2
α-helix	368-375	8
β-strand	378	1	4
β-strand	382-388	7	4
β-strand	394-402	9	4
β-strand	405-407	3	3
β-strand	415-416	2	3
β-strand	418-421	4	4
β-strand	425	1	4
α-helix	431-444	14
β-strand	449-453	5	4
α-helix	459-462	4
β-strand	468-469	2	4
β-strand	470	1	5
β-strand	474-479	6	2
β-strand	482	1	1
α-helix	488-490	3
β-strand	491	1	2

Chain B: 19 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	109-114	6
α-helix	120-122	3
α-helix	126-127	2
α-helix	130-132	3
β-strand	136	1	6
α-helix	140-142	3
α-helix	149-153	5
β-strand	156-160	5	7
α-helix	166-179	14
β-strand	182	1	8
β-strand	188-190	3	8
α-helix	194-201	8
α-helix	208-210	3
β-strand	211-216	6	7
β-strand	222-235	14	7
β-strand	238-250	13	7
α-helix	252-254	3
α-helix	259-272	14
β-strand	279-283	5	7
β-strand	292-300	9	7
α-helix	303-308	6
α-helix	320-326	7
β-strand	338-340	3	7
α-helix	343-345	3
α-helix	346-357	12
β-strand	362-365	4	7
α-helix	368-375	8
β-strand	378	1	7
β-strand	382-388	7	7
β-strand	394-402	9	7
β-strand	405-407	3	8
β-strand	416	1	8
β-strand	418-421	4	7
β-strand	425-426	2	7
α-helix	431-444	14
β-strand	449-453	5	7
α-helix	458-460	3
β-strand	468-479	12	7
β-strand	482	1	6
α-helix	488-490	3
β-strand	491	1	7

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	8	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycylpeptide N-tetradecanoyltransferase 1	A, B	protein	402	Homo sapiens	P30419 (AlphaFold model)
Neuron-specific calcium-binding protein hippocalcin	C	protein	8	Homo sapiens	P84074 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7OWM_1 Glycylpeptide N-tetradecanoyltransferase 1 (chains A, B)
GGSEFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQ
GFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLE
GIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPK
TAGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEV
TDFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALD
LMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

Sequence of entity 2 (C), FASTA

>7OWM_2 Neuron-specific calcium-binding protein hippocalcin (chains C)
GKQNSKLR

Ligands and cofactors

ID	Name	Formula	Copies
MYA	Tetradecanoyl-CoA	C35 H62 N7 O17 P3 S	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural and Large-scale Analysis Unveil the Intertwined Paths Promoting NMT-catalyzed Lysine and Glycine Myristoylation. Riviere, F., Dian, C., Dutheil, R.F. et al. J Mol Biol (2022) 434:167843-167843. DOI 10.1016/j.jmb.2022.167843 · PubMed

Other PDB entries of the same protein (UniProt P30419 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O6H 1.29 Å, Human NMT1 in complex with myristoyl-CoA and inhibitor IMP-917
3IU1 1.42 Å, Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA
5O6J 1.45 Å, Human NMT1 in complex with myristoyl-CoA and inhibitor IMP-1031
3JTK 1.61 Å, Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and…
4C2Y 1.64 Å, Human N-myristoyltransferase (NMT1) with Myristoyl-CoA co-factor
7OWO 1.7 Å, HsNMT1 in complex with both MyrCoA and N-acetylated KSFSKPR peptide
3IU2 1.73 Å, Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and…
8Q3S 1.78 Å, HsNMT1 in complex with both MyrCoA and GNCFSKAR inhibitor peptide
3IWE 1.79 Å, Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and…
7OWP 1.81 Å, HsNMT1 in complex with both MyrCoA and ACE-G-(L-ORN)SFSKPR
5O9U 1.85 Å, HsNMT1 in complex with CoA and Myristoylated-GCSVSKKK octapeptide
6SK8 1.87 Å, DeltaC3 C-terminal truncation of HsNMT1 in complex with MyrCoA and GDCFSKPR substrates

Browse structure collections

About this viewer

MolViewer shows 7OWM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.