The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Jul 2022.
Explore 7P70 in 3D Show helices and sheets RCSB PDB PDBe
7P70 contains 23 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 111-116 | 6 | 1 |
| β-strand | 118 | 1 | 2 |
| β-strand | 122 | 1 | 2 |
| β-strand | 125-128 | 4 | 1 |
| α-helix | 131-133 | 3 | |
| β-strand | 138-142 | 5 | 1 |
| α-helix | 147-151 | 5 | |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 166-167 | 2 | 1 |
| α-helix | 173-182 | 10 | |
| β-strand | 186-193 | 8 | 1 |
| α-helix | 211-223 | 13 | |
| α-helix | 229-236 | 8 | |
| α-helix | 241-255 | 15 | |
| α-helix | 259-266 | 8 | |
| α-helix | 269-279 | 11 | |
| α-helix | 282-293 | 12 | |
| α-helix | 301-310 | 10 | |
| α-helix | 313-327 | 15 | |
| α-helix | 331-338 | 8 | |
| α-helix | 341-351 | 11 | |
| α-helix | 355-357 | 3 | |
| α-helix | 364-377 | 14 | |
| α-helix | 386-395 | 10 | |
| α-helix | 398-411 | 14 | |
| α-helix | 416-423 | 8 | |
| α-helix | 426-454 | 29 | |
| α-helix | 461-471 | 11 | |
| α-helix | 476-487 | 12 | |
| α-helix | 491-498 | 8 | |
| α-helix | 501-511 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 146-148 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein E6 | C | protein | 13 | Human papillomavirus 35 | P27228 (AlphaFold model) |
| Beta-1-syntrophin,Annexin A2 | A | protein | 414 | Homo sapiens | P07355 (AlphaFold model), Q13884 (AlphaFold model) |
>7P70_1 Protein E6 (chains C) TDDSKPTRRETEV
>7P70_2 Beta-1-syntrophin,Annexin A2 (chains A) GSHMGSNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAIL SVNGADLRDATHDEAVQALKRAGKEVLLEVKYMREGSAYGSVKAYTNFDAERDALNIETA IKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKT PAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSG DFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRD KVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 5 |
Water and common crystallization additives (GOL) are not listed.
Quantitative fragmentomics allow affinity mapping of interactomes. Gogl, G., Zambo, B., Kostmann, C. et al. Nat Commun (2022) 13:5472-5472. DOI 10.1038/s41467-022-33018-0 · PubMed
Other PDB entries of the same protein (UniProt P27228 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7P70 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.