7PED: DEPTOR DEP domain tandem

DEPTOR DEP domain tandem (DEPt). Determined by X-ray diffraction at 1.93 Å resolution. Released 8 Sept 2021.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,776
Mol. weight: 54.26 kDa
Released: 8 Sept 2021

Explore 7PED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PED contains 19 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	22-46	25
β-strand	51-55	5	6
β-strand	58-63	6	6
β-strand	64-65	2	3
α-helix	66-75	10
α-helix	82-94	13
β-strand	98-100	3	3
β-strand	114-117	4	2
α-helix	118-120	3
α-helix	128-143	16
β-strand	152-156	5	7
β-strand	159-164	6	7
β-strand	165-166	2	8
α-helix	167-177	11
α-helix	183-195	13
β-strand	199-201	3	8
β-strand	214-217	4	8
α-helix	221-226	6
α-helix	227-229	3

Chain B: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	21-46	26
β-strand	51-55	5	1
β-strand	58-63	6	1
β-strand	64-65	2	2
α-helix	66-75	10
α-helix	82-94	13
β-strand	98-100	3	2
β-strand	114-117	4	3
α-helix	118-120	3
α-helix	128-143	16
β-strand	152-156	5	4
β-strand	159-164	6	4
β-strand	165-166	2	5
α-helix	167-176	10
α-helix	183-195	13
β-strand	199-201	3	5
α-helix	206-208	3
β-strand	214-217	4	5
α-helix	221-226	6
α-helix	227-229	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DEP domain-containing mTOR-interacting protein	A, B	protein	230	Homo sapiens	Q8TB45 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7PED_1 DEP domain-containing mTOR-interacting protein (chains A, B)
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTY
PNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKD
DGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEA
TTRKEAEQLCHRLMEHGIIQHVSSKHPFVDSNLLYQFRMNFRRRRRLMEL

Primary citation

Regulation of human mTOR complexes by DEPTOR. Walchli, M., Berneiser, K., Mangia, F. et al. Elife (2021) 10. DOI 10.7554/eLife.70871 · PubMed

Other PDB entries of the same protein (UniProt Q8TB45 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DKL 1.5 Å, Crystal structure of the tandem DEP domains of DEPTOR
7PE8 3.2 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, focussed on one protomer
7PE7 3.41 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, overall refinement
7PEB 3.67 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, focussed on one protomer
7PE9 3.7 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, DEPt-bound subset local…
7PEA 4.07 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, overall refinement
7PEC 4.24 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, DEPt-bound subset local…
7OWG 4.7 Å, human DEPTOR in a complex with mutant human mTORC1 A1459P

Browse structure collections

About this viewer

MolViewer shows 7PED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.