7PG5: PI3Kalpha

Crystal Structure of PI3Kalpha. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,787
Mol. weight: 159.1 kDa
Ligands: PO4
Released: 24 Aug 2022

Explore 7PG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PG5 contains 68 α-helices and 57 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 62 helices, 50 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	10	1	2
β-strand	11	1	1
β-strand	13	1	2
β-strand	19-25	7	3
β-strand	31-37	7	3
β-strand	41	1	4
α-helix	42-52	11
α-helix	53-55	3
α-helix	59-61	3
α-helix	65-67	3
β-strand	69-73	5	3
β-strand	74	1	5
β-strand	79-82	4	3
β-strand	88	1	4
α-helix	89-91	3
β-strand	94	1	5
β-strand	98-102	5	3
α-helix	108-121	14
α-helix	126-129	4
α-helix	134-142	9
α-helix	144-155	12
α-helix	160-166	7
β-strand	171	1	6
α-helix	176-178	3
α-helix	179-182	4
β-strand	186	1	7
β-strand	189-198	10	7
β-strand	203-212	10	7
α-helix	217-228	12
α-helix	236-246	11
α-helix	247-249	3
β-strand	250-254	5	7
β-strand	260	1	7
α-helix	267-269	3
β-strand	270	1	6
α-helix	271-279	9
β-strand	284-289	6	7
α-helix	290-294	5
α-helix	306-309	4
β-strand	324-326	3	8
α-helix	327-329	3
β-strand	333-341	9	9
β-strand	353-362	10	10
β-strand	365-366	2	10
β-strand	371-372	2	10
α-helix	373-375	3
β-strand	376	1	10
β-strand	382-392	11	9
α-helix	393-395	3
β-strand	401-413	13	10
β-strand	416-428	13	10
β-strand	430	1	11
β-strand	435	1	8
β-strand	436	1	11
α-helix	437	1
β-strand	439-444	6	9
β-strand	446	1	10
α-helix	447-449	3
α-helix	461-462	2
β-strand	472-477	6	9
β-strand	483-485	3	8
α-helix	486-488	3
α-helix	489-496	8
α-helix	524-535	12
α-helix	545-553	9
α-helix	557-560	4
α-helix	562-564	3
α-helix	565-571	7
α-helix	577-588	12
α-helix	590-592	3
α-helix	595-598	4
α-helix	599-602	4
α-helix	609-622	14
α-helix	625-630	6
α-helix	632-637	6
α-helix	638-641	4
α-helix	648-659	12
α-helix	661-673	13
α-helix	681-694	14
α-helix	698-720	23
α-helix	728-739	12
α-helix	742-748	7
β-strand	751-752	2	12
β-strand	760-761	2	12
β-strand	764	1	13
α-helix	766-768	3
β-strand	770-771	2	13
β-strand	779-784	6	13
α-helix	790-792	3
β-strand	796-803	8	13
α-helix	808-826	19
β-strand	838-842	5	13
β-strand	845-849	5	13
α-helix	850-851	2
β-strand	854-856	3	14
α-helix	857-861	5
α-helix	876-884	9
α-helix	887-889	3
α-helix	890-911	22
β-strand	921-924	4	14
β-strand	929-931	3	14
α-helix	942-945	4
α-helix	958-964	7
α-helix	971-973	3
α-helix	975-993	19
α-helix	995-1003	9
α-helix	1006-1008	3
α-helix	1016-1025	10
α-helix	1032-1047	16
β-strand	1055	1	15
β-strand	1062	1	15

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	334	1	16
α-helix	340-347	8
α-helix	350-351	2
β-strand	354-359	6	16
β-strand	368-374	7	16
β-strand	377-383	7	16
β-strand	384-386	3	17
β-strand	389-391	3	17
α-helix	401-410	10
β-strand	426-427	2	16
α-helix	430-433	4
α-helix	442-514	73
α-helix	519-586	68

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform	A	protein	1068	Homo sapiens	P42336 (AlphaFold model)
Phosphatidylinositol 3-kinase regulatory subunit alpha	B	protein	287	Homo sapiens	P27986 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PG5_1 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (chains A)
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSKKLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN

Sequence of entity 2 (B), FASTA

>7PG5_2 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains B)
LPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHG
DYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLY
PVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEA
FNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLE
EDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

A small-molecule PI3K alpha activator for cardioprotection and neuroregeneration. Gong, G.Q., Bilanges, B., Allsop, B. et al. Nature (2023) 618:159-168. DOI 10.1038/s41586-023-05972-2 · PubMed

Other PDB entries of the same protein (UniProt P42336 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CMK 1.75 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASF 1.77 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide analogue…
9CX0 1.92 Å, Crystal structure of HLA-A*03:01 E152V mutant in complex with a mutant PIK3CA peptide
7L1C 1.96 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide
9CWY 1.98 Å, Crystal structure of HLA-A*03:02 in complex with a wild-type PIK3CA peptide
8EXL 1.99 Å, Crystal structure of PI3K-alpha in complex with taselisib
9CX1 2.0 Å, Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide
9CML 2.01 Å, Crystal structure of p110alpha-RAS binding domain (RBD) in complex with molecular glue…
9ASG 2.03 Å, Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide analogue (Trp-6…
7L1B 2.04 Å, Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide
9CWZ 2.05 Å, Crystal structure of HLA-A*03:02 in complex with a mutant PIK3CA peptide
7JIU 2.12 Å, Human PI3KDELTA in complex with compound 2F

Browse structure collections

About this viewer

MolViewer shows 7PG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.