Crystal structure of the human spliceosomal maturation factor AAR2 bound to the RNAse H domain of PRPF8. Determined by X-ray diffraction at 2.35 Å resolution. Released 2 Nov 2022.
Explore 7PJH in 3D Show helices and sheets RCSB PDB PDBe
7PJH contains 36 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-13 | 3 | |
| α-helix | 14-17 | 4 | |
| β-strand | 19-24 | 6 | 1 |
| α-helix | 26-27 | 2 | |
| β-strand | 31-34 | 4 | 2 |
| β-strand | 37-40 | 4 | 2 |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 52 | 1 | |
| β-strand | 54-61 | 8 | 2 |
| β-strand | 65 | 1 | 3 |
| β-strand | 67 | 1 | 3 |
| β-strand | 75-81 | 7 | 2 |
| β-strand | 86-92 | 7 | 1 |
| β-strand | 97-99 | 3 | 1 |
| α-helix | 102-104 | 3 | |
| α-helix | 105-118 | 14 | |
| α-helix | 119-121 | 3 | |
| β-strand | 122-124 | 3 | 1 |
| α-helix | 125 | 1 | |
| α-helix | 127-129 | 3 | |
| α-helix | 130-137 | 8 | |
| α-helix | 142-148 | 7 | |
| β-strand | 155-156 | 2 | 2 |
| α-helix | 208-210 | 3 | |
| α-helix | 222-230 | 9 | |
| α-helix | 233-243 | 11 | |
| α-helix | 250-263 | 14 | |
| α-helix | 268-282 | 15 | |
| α-helix | 285-290 | 6 | |
| α-helix | 292-306 | 15 | |
| α-helix | 323-335 | 13 | |
| α-helix | 342-359 | 18 | |
| α-helix | 366-367 | 2 | |
| α-helix | 368-370 | 3 | |
| α-helix | 371-372 | 2 | |
| β-strand | 373-374 | 2 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1762-1763 | 2 | 5 |
| α-helix | 1768-1772 | 5 | |
| β-strand | 1777-1781 | 5 | 6 |
| β-strand | 1787-1792 | 6 | 4 |
| β-strand | 1798-1803 | 6 | 4 |
| β-strand | 1805-1810 | 6 | 6 |
| β-strand | 1816-1822 | 7 | 6 |
| α-helix | 1824-1827 | 4 | |
| α-helix | 1833-1851 | 19 | |
| α-helix | 1854-1856 | 3 | |
| β-strand | 1860-1863 | 4 | 6 |
| α-helix | 1866-1868 | 3 | |
| α-helix | 1869-1875 | 7 | |
| β-strand | 1883-1885 | 3 | 6 |
| β-strand | 1886-1887 | 2 | 5 |
| α-helix | 1893-1898 | 6 | |
| α-helix | 1900-1908 | 9 | |
| β-strand | 1913-1918 | 6 | 6 |
| α-helix | 1923-1925 | 3 | |
| α-helix | 1929-1945 | 17 | |
| α-helix | 1947-1953 | 7 | |
| α-helix | 1973-1995 | 23 | |
| α-helix | 2006-2012 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein AAR2 homolog | A | protein | 401 | Homo sapiens | Q9Y312 (AlphaFold model) |
| Pre-mRNA-processing-splicing factor 8 | B | protein | 259 | Homo sapiens | Q6P2Q9 (AlphaFold model) |
>7PJH_1 Protein AAR2 homolog (chains A) MKHHHHHHPMSDYDIPTTENLYFQGAEFMAAVQMDPELAKRLFFEGATVVILNMPKGTEF GIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWS TLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFISEATVEKLQPEN RQICAFSDLPVLSMKHSSSRAGTEIRFSELPTQMFPERAGTEIRFSELPTQMFPEGATPA EITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLLCR SEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDAT LRKKAEKFQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG
>7PJH_2 Pre-mRNA-processing-splicing factor 8 (chains B) PTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQL FLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLL DFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLI LILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNV NVASLTQSEIRDIILGMEI
Structural and functional investigation of the human snRNP assembly factor AAR2 in complex with the RNase H-like domain of PRPF8. Preussner, M., Santos, K.F., Alles, J. et al. Acta Crystallogr D Struct Biol (2022) 78:1373-1383. DOI 10.1107/S2059798322009755 · PubMed
MolViewer shows 7PJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.