Crystal structure of Angiotensin-1 converting enzyme N-domain in complex with dual ACE/NEP inhibitor AD012. Determined by X-ray diffraction at 1.6 Å resolution. Released 16 Feb 2022.
Explore 7Q25 in 3D Show helices and sheets RCSB PDB PDBe
7Q25 contains 76 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| α-helix | 14-43 | 30 | |
| α-helix | 48-75 | 28 | |
| α-helix | 80-82 | 3 | |
| α-helix | 86-95 | 10 | |
| α-helix | 99-102 | 4 | |
| α-helix | 105-124 | 20 | |
| β-strand | 126-128 | 3 | 1 |
| β-strand | 136-138 | 3 | 1 |
| α-helix | 139-143 | 5 | |
| α-helix | 144-149 | 6 | |
| α-helix | 153-163 | 11 | |
| α-helix | 164-168 | 5 | |
| α-helix | 169-187 | 19 | |
| α-helix | 194-200 | 7 | |
| α-helix | 207-237 | 31 | |
| α-helix | 247 | 1 | |
| β-strand | 248-249 | 2 | 2 |
| α-helix | 262-264 | 3 | |
| α-helix | 265-268 | 4 | |
| α-helix | 280-286 | 7 | |
| α-helix | 290-303 | 14 | |
| α-helix | 307-310 | 4 | |
| α-helix | 311-316 | 6 | |
| β-strand | 318 | 1 | 3 |
| β-strand | 333-336 | 4 | 3 |
| β-strand | 343-346 | 4 | 3 |
| α-helix | 353-372 | 20 | |
| α-helix | 377-379 | 3 | |
| α-helix | 385-399 | 15 | |
| α-helix | 402-407 | 6 | |
| α-helix | 418-432 | 15 | |
| α-helix | 435-451 | 17 | |
| α-helix | 456-458 | 3 | |
| α-helix | 459-466 | 8 | |
| α-helix | 467-471 | 5 | |
| β-strand | 473-474 | 2 | 2 |
| α-helix | 485-488 | 4 | |
| α-helix | 491-494 | 4 | |
| α-helix | 499-518 | 20 | |
| α-helix | 525-527 | 3 | |
| α-helix | 534-546 | 13 | |
| α-helix | 552-560 | 9 | |
| α-helix | 568-587 | 20 | |
| α-helix | 590-591 | 2 | |
| α-helix | 601-604 | 4 | |
| α-helix | 609-611 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| α-helix | 14-43 | 30 | |
| α-helix | 48-76 | 29 | |
| α-helix | 80-82 | 3 | |
| α-helix | 86-95 | 10 | |
| α-helix | 99-102 | 4 | |
| α-helix | 105-124 | 20 | |
| β-strand | 126-128 | 3 | 4 |
| β-strand | 136-138 | 3 | 4 |
| α-helix | 139-143 | 5 | |
| α-helix | 144-149 | 6 | |
| α-helix | 153-187 | 35 | |
| α-helix | 194-200 | 7 | |
| α-helix | 207-237 | 31 | |
| α-helix | 247 | 1 | |
| β-strand | 248-249 | 2 | 5 |
| α-helix | 262-264 | 3 | |
| α-helix | 265-268 | 4 | |
| α-helix | 280-285 | 6 | |
| α-helix | 290-303 | 14 | |
| α-helix | 307-310 | 4 | |
| α-helix | 311-316 | 6 | |
| β-strand | 318 | 1 | 6 |
| β-strand | 333-336 | 4 | 6 |
| β-strand | 343-346 | 4 | 6 |
| α-helix | 353-372 | 20 | |
| α-helix | 377-379 | 3 | |
| α-helix | 385-399 | 15 | |
| α-helix | 402-407 | 6 | |
| α-helix | 418-432 | 15 | |
| α-helix | 435-451 | 17 | |
| α-helix | 456-458 | 3 | |
| α-helix | 459-466 | 8 | |
| α-helix | 467-471 | 5 | |
| β-strand | 473-474 | 2 | 5 |
| α-helix | 485-488 | 4 | |
| α-helix | 499-518 | 20 | |
| α-helix | 525-527 | 3 | |
| α-helix | 534-546 | 13 | |
| α-helix | 552-560 | 9 | |
| α-helix | 568-587 | 20 | |
| α-helix | 590-591 | 2 | |
| α-helix | 601-604 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiotensin-converting enzyme | A, B | protein | 629 | Homo sapiens | P12821 (AlphaFold model) |
>7Q25_1 Angiotensin-converting enzyme (chains A, B) LDPGLQPGQFSADEAGAQLFAQSYQSSAEQVLFQSVAASWAHDTNITAENARRQEEAALL SQEFAEAWGQKAKELYEPIWQQFTDPQLRRIIGAVRTLGSANLPLAKRQQYNALLSQMSR IYSTAKVCLPQKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTA LSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDR YINLRGPIPAHLLGDMWAQSWENIYDMVVPFPDKPNLDVTSTMLQQGWQATHMFRVAEEF FTSLELSPMPPEFWEGSMLEKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVH HEMGHIQYYLQYKDLPVSLRRGANPGFHEAIGDVLALSVSTPEHLHKIGLLDRVTNDTES DINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVTRN ETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEGPLHQCDIYRSTKAGAKL RKVLRAGSSRPWQEVLKDMVGLDALDAQPLLKYFQLVTQWLQEQNQQNGEVLGWPEYQWH PPLPDNYPEGIDLVTDEAEASKFVEEYDL
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| 8J9 | (2~{S})-2-[[(2~{S})-1-[[(2~{S})-3-(4-hydroxyphenyl)-1-oxidanyl-1-oxidanylidene-… | C25 H32 N2 O6 | 2 |
| MG | Magnesium ion | Mg | 2 |
| ZN | Zinc ion | Zn | 2 |
| P33 | 3,6,9,12,15,18-hexaoxaicosane-1,20-diol | C14 H30 O8 | 1 |
Water and common crystallization additives (PEG, EDO, 1PE, ACT, PG4, CL) are not listed.
Probing the Requirements for Dual Angiotensin-Converting Enzyme C-Domain Selective/Neprilysin Inhibition. Arendse, L.B., Cozier, G.E., Eyermann, C.J. et al. J Med Chem (2022) 65:3371-3387. DOI 10.1021/acs.jmedchem.1c01924 · PubMed
Other PDB entries of the same protein (UniProt P12821 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7Q25 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.