7Q5T: Tyrosine-protein kinase SYK
The tandem SH2 domains of SYK with a bound FCER1G diphospho-ITAM peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Nov 2021.
- Method
- X-ray diffraction
- Resolution
- 2.2 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 13,506
- Mol. weight
- 195.55 kDa
- Ligands
- PO4
- Released
- 24 Nov 2021
Explore 7Q5T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7Q5T contains 88 α-helices and 124 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain AAA: 13 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-12 | 4 | |
| β-strand | 16 | 1 | 1 |
| β-strand | 18 | 1 | 2 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 51-57 | 7 | 1 |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69 | 1 | |
| β-strand | 74-76 | 3 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 82 | 1 | 1 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 1 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 2 |
| α-helix | 119-136 | 18 | |
| α-helix | 140-161 | 22 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 4 |
| α-helix | 175-182 | 8 | |
| β-strand | 192-196 | 5 | 4 |
| β-strand | 203-209 | 7 | 4 |
| β-strand | 212-218 | 7 | 4 |
| β-strand | 219-220 | 2 | 5 |
| β-strand | 226-227 | 2 | 5 |
| α-helix | 232-233 | 2 | |
| β-strand | 234 | 1 | 5 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 6 |
| β-strand | 251 | 1 | 6 |
| β-strand | 258 | 1 | 4 |
| α-helix | 259-261 | 3 | |
Chain BBB: 12 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 7 |
| β-strand | 18 | 1 | 8 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 7 |
| β-strand | 51-57 | 7 | 7 |
| β-strand | 60-68 | 9 | 7 |
| α-helix | 69 | 1 | |
| β-strand | 74-76 | 3 | 7 |
| β-strand | 82 | 1 | 7 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 7 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 8 |
| α-helix | 119-136 | 18 | |
| α-helix | 140-149 | 10 | |
| α-helix | 151-161 | 11 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 9 |
| α-helix | 175-182 | 8 | |
| β-strand | 192-196 | 5 | 9 |
| β-strand | 203-209 | 7 | 9 |
| β-strand | 212-218 | 7 | 9 |
| β-strand | 219-220 | 2 | 10 |
| β-strand | 226-227 | 2 | 10 |
| β-strand | 234 | 1 | 10 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 11 |
| β-strand | 251 | 1 | 11 |
| β-strand | 258 | 1 | 9 |
| α-helix | 259-261 | 3 | |
Chain CCC: 12 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 12 |
| β-strand | 18 | 1 | 13 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 12 |
| β-strand | 51-57 | 7 | 12 |
| β-strand | 60-66 | 7 | 12 |
| β-strand | 67-68 | 2 | 14 |
| α-helix | 69 | 1 | |
| β-strand | 74-75 | 2 | 14 |
| β-strand | 82 | 1 | 14 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 12 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 13 |
| α-helix | 119-136 | 18 | |
| α-helix | 140-161 | 22 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 15 |
| β-strand | 171 | 1 | 3 |
| α-helix | 175-183 | 9 | |
| β-strand | 192-196 | 5 | 15 |
| β-strand | 203-209 | 7 | 15 |
| β-strand | 212-218 | 7 | 15 |
| β-strand | 219-220 | 2 | 16 |
| β-strand | 226-227 | 2 | 16 |
| α-helix | 232-233 | 2 | |
| β-strand | 234 | 1 | 16 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 17 |
| β-strand | 251 | 1 | 17 |
| β-strand | 258 | 1 | 15 |
| α-helix | 259-261 | 3 | |
| β-strand | 265 | 1 | 3 |
Chain DDD: 13 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 18 |
| β-strand | 18 | 1 | 19 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 18 |
| β-strand | 51-57 | 7 | 18 |
| β-strand | 60-66 | 7 | 18 |
| β-strand | 67-68 | 2 | 20 |
| α-helix | 69 | 1 | |
| β-strand | 74-75 | 2 | 20 |
| β-strand | 82 | 1 | 20 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 18 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 19 |
| α-helix | 119-136 | 18 | |
| α-helix | 143-149 | 7 | |
| α-helix | 152-161 | 10 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 21 |
| α-helix | 175-183 | 9 | |
| β-strand | 192-196 | 5 | 21 |
| β-strand | 203-209 | 7 | 21 |
| β-strand | 212-218 | 7 | 21 |
| β-strand | 219-220 | 2 | 22 |
| β-strand | 226-227 | 2 | 22 |
| α-helix | 232-233 | 2 | |
| β-strand | 234 | 1 | 22 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 23 |
| β-strand | 251 | 1 | 23 |
| β-strand | 258 | 1 | 21 |
| α-helix | 259-261 | 3 | |
Chain EEE: 13 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 24 |
| β-strand | 18 | 1 | 25 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 24 |
| β-strand | 51-57 | 7 | 24 |
| β-strand | 60-66 | 7 | 24 |
| β-strand | 67-68 | 2 | 26 |
| α-helix | 69 | 1 | |
| β-strand | 74-75 | 2 | 26 |
| β-strand | 82 | 1 | 26 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 24 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 25 |
| α-helix | 119-135 | 17 | |
| α-helix | 140-149 | 10 | |
| α-helix | 151-161 | 11 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 27 |
| α-helix | 175-183 | 9 | |
| β-strand | 192-196 | 5 | 27 |
| β-strand | 203-209 | 7 | 27 |
| β-strand | 212-218 | 7 | 27 |
| β-strand | 219-220 | 2 | 28 |
| β-strand | 226-227 | 2 | 28 |
| α-helix | 232-233 | 2 | |
| β-strand | 234 | 1 | 28 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 29 |
| β-strand | 251 | 1 | 29 |
| β-strand | 258 | 1 | 27 |
| α-helix | 259-261 | 3 | |
Chain FFF: 13 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 30 |
| β-strand | 18 | 1 | 31 |
| α-helix | 22-31 | 10 | |
| β-strand | 38-43 | 6 | 30 |
| β-strand | 51-57 | 7 | 30 |
| β-strand | 60-66 | 7 | 30 |
| β-strand | 67-68 | 2 | 32 |
| α-helix | 69 | 1 | |
| β-strand | 74-75 | 2 | 32 |
| β-strand | 82 | 1 | 32 |
| α-helix | 85-94 | 10 | |
| β-strand | 105-106 | 2 | 30 |
| α-helix | 108-110 | 3 | |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 31 |
| α-helix | 119-130 | 12 | |
| α-helix | 141-149 | 9 | |
| α-helix | 151-161 | 11 | |
| α-helix | 162-165 | 4 | |
| β-strand | 169 | 1 | 33 |
| α-helix | 175-183 | 9 | |
| β-strand | 192-196 | 5 | 33 |
| β-strand | 203-209 | 7 | 33 |
| β-strand | 212-218 | 7 | 33 |
| β-strand | 219-220 | 2 | 34 |
| β-strand | 226-227 | 2 | 34 |
| α-helix | 232-233 | 2 | |
| β-strand | 234 | 1 | 34 |
| α-helix | 237-246 | 10 | |
| β-strand | 249 | 1 | 35 |
| β-strand | 251 | 1 | 35 |
| β-strand | 258 | 1 | 33 |
| α-helix | 259-261 | 3 | |
Chain GGG: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 65-72 | 8 | |
| α-helix | 75-77 | 3 | |
Chains HHH and JJJ: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 65-68 | 4 | |
| α-helix | 74-76 | 3 | |
| β-strand | 77 | 1 | 12 |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tyrosine-protein kinase SYK | AAA, BBB, CCC, DDD, EEE, FFF | protein | 265 | Homo sapiens | P43405 (AlphaFold model) |
| High affinity immunoglobulin epsilon receptor subunit gamma | GGG, HHH, III, JJJ, KKK, LLL | protein | 20 | Homo sapiens | P30273 (AlphaFold model) |
Sequence of entity 1 (AAA, BBB, CCC, DDD, EEE, FFF), FASTA
>7Q5T_1 Tyrosine-protein kinase SYK (chains AAA, BBB, CCC, DDD, EEE, FFF)
SMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKAHHY
TIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPFEDLK
ENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQIVLI
GSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHY
SYKADGLLRVLTVPCQKIGTQGNVN
Sequence of entity 2 (GGG, HHH, III, JJJ, KKK, LLL), FASTA
>7Q5T_2 High affinity immunoglobulin epsilon receptor subunit gamma (chains GGG, HHH, III, JJJ, KKK, LLL)
DGVYTGLSTRNQETYETLKH
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PO4 | Phosphate ion | O4 P | 9 |
Water and common crystallization additives (PEG, EDO) are not listed.
Primary citation
The mechanism of allosteric activation of SYK kinase derived from multiple phospho-ITAM-bound structures. Bradshaw, W.J., Harris, G., Gileadi, O. et al. Structure (2024) 32:2337-2351.e4. DOI 10.1016/j.str.2024.09.024 · PubMed
Other PDB entries of the same protein (UniProt P43405 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4YJR 1.32 Å, SYK kinase domain in complex with inhibitor GTC000225
- 4YJQ 1.34 Å, SYK kinase domain in complex with inhibitor GTC000224
- 4FYO 1.4 Å, Crystal structure of spleen tyrosine kinase complexed with…
- 5LMA 1.43 Å, Human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
- 3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
- 6ZCS 1.47 Å, SYK Kinase domain in complex with azabenzimidazole inhibitor 3
- 5TIU 1.49 Å, Crystal structure of SYK kinase domain with inhibitor
- 8XQ1 1.5 Å, Crystal structure of spleen tyrosine kinase(SYK) in complex with SKI-G-1673
- 8BI2 1.51 Å, Syk kinase domain in complex with macrocyclic inhibitor 20a
- 4YJT 1.52 Å, The kinase domain of human spleen tyrosine (SYK) in complex with GTC000233
- 1XBB 1.57 Å, Crystal structure of the syk tyrosine kinase domain with Gleevec
- 4RX8 1.59 Å, SYK Catalytic Domain Complexed with a Potent Triazine Inhibitor2
Browse structure collections
About this viewer
MolViewer shows 7Q5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.