7QAA: Retinoic acid receptor RXR-alpha

Crystal structure of RARalpha/RXRalpha ligand binding domain heterodimer in complex with BMS614 and oleic acid. Determined by X-ray diffraction at 2.76 Å resolution. Released 5 Oct 2022.

Method: X-ray diffraction
Resolution: 2.76 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,654
Mol. weight: 53.38 kDa
Ligands: BMS, OLA
Released: 5 Oct 2022

Explore 7QAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QAA contains 28 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	231-234	4
α-helix	237-247	11
α-helix	269-281	13
α-helix	284-289	6
α-helix	299-321	23
β-strand	328-330	3	1
β-strand	336-338	3	1
α-helix	339-344	6
α-helix	348-353	6
α-helix	354-359	6
α-helix	360-364	5
α-helix	369-380	12
α-helix	391-412	22
α-helix	419-424	6
α-helix	426-438	13
α-helix	452-460	9

Chain B: 14 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	183-198	16
α-helix	202-204	3
β-strand	208	1	2
α-helix	222-245	24
α-helix	254-274	21
β-strand	277-278	2	3
β-strand	283-285	3	3
β-strand	290	1	2
β-strand	291-293	3	3
α-helix	294-297	4
α-helix	298-302	5
α-helix	303-305	3
α-helix	306-316	11
α-helix	317-319	3
α-helix	323-334	12
α-helix	345-366	22
α-helix	373-378	6
α-helix	380-401	22
α-helix	410-415	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor RXR-alpha	A	protein	233	Mus musculus	P28700 (AlphaFold model)
Isoform Alpha-1-deltaBC of Retinoic acid receptor alpha	B	protein	235	Homo sapiens	P10276 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QAA_1 Retinoic acid receptor RXR-alpha (chains A)
SANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAK
RIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGA
IFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYC
KHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA

Sequence of entity 2 (B), FASTA

>7QAA_2 Isoform Alpha-1-deltaBC of Retinoic acid receptor alpha (chains B)
PEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVE
FAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAG
FGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKV
YVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLEN

Ligands and cofactors

ID	Name	Formula	Copies
BMS	4-[(4,4-dimethyl-1,2,3,4-tetrahydro-[1,2']BINAPTHALENYL-7-carbonyl)-amino]-benz…	C29 H26 N2 O3	1
OLA	Oleic acid	C18 H34 O2	1

Primary citation

Design and in vitro characterization of RXR variants as tools to investigate the biological role of endogenous rexinoids. le Maire, A., Rey, M., Vivat, V. et al. J Mol Endocrinol (2022) 69:377-390. DOI 10.1530/JME-22-0021 · PubMed

Other PDB entries of the same protein (UniProt P28700 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PDQ 1.58 Å, Crystal structure of a mutated form of RXRalpha ligand binding domain in complex with…
1DKF 2.5 Å, Crystal structure of a heterodimeric complex of rar and rxr ligand-binding domains
7AOS 2.55 Å, crystal structure of the RARalpha/RXRalpha ligand binding domain heterodimer in complex…
8J54 2.72 Å, Crystal structure of RXR/DR2 complex
3A9E 2.75 Å, Crystal structure of a mixed agonist-bound RAR-alpha and antagonist-bound RXR-alpha…
1XDK 2.9 Å, Crystal Structure of the RARbeta/RXRalpha Ligand Binding Domain Heterodimer in Complex…
7PDT 3.3 Å, Crystal structure of a mutated form of RXRalpha ligand binding domain in complex with…

Browse structure collections

About this viewer

MolViewer shows 7QAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.