7QCR: MLLT4/Afadin PDZ domain

MLLT4/Afadin PDZ domain in complex with the C-terminal peptide from protein E of SARS-CoV-2. Determined by X-ray diffraction at 2.28 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.28 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 4
Atoms: 1,408
Mol. weight: 22.88 kDa
Released: 20 Apr 2022

Explore 7QCR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QCR contains 6 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	13	1	2
β-strand	16-21	6	3
β-strand	30-36	7	3
α-helix	37	1
α-helix	41-45	5
β-strand	53-57	5	3
β-strand	60-61	2	3
α-helix	67-75	9
β-strand	80-86	7	3

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	3
β-strand	11	1	2
β-strand	16-21	6	1
β-strand	30-36	7	1
α-helix	37	1
α-helix	41-45	5
β-strand	53-57	5	1
β-strand	60-61	2	1
α-helix	67-75	9
β-strand	80-86	7	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	103	1	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	120-121	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Afadin	A, B	protein	97	Homo sapiens	P55196 (AlphaFold model)
Envelope small membrane protein	C, D	protein	12	Severe acute respiratory syndrome coronavirus 2	P0DTC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7QCR_1 Afadin (chains A, B)
GRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLS
VDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYH

Sequence of entity 2 (C, D), FASTA

>7QCR_2 Envelope small membrane protein (chains C, D)
NLNSSRVPDLLV

Primary citation

Interactions of Severe Acute Respiratory Syndrome Coronavirus 2 Protein E With Cell Junctions and Polarity PSD-95/Dlg/ZO-1-Containing Proteins. Zhu, Y., Alvarez, F., Wolff, N. et al. Front Microbiol (2022) 13:829094-829094. DOI 10.3389/fmicb.2022.829094 · PubMed

Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5A6C 2.9 Å, Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation
1T2M Solution Structure Of The Pdz Domain Of AF-6
1XZ9 Structure of AF-6 PDZ domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
2EXG Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands…

Browse structure collections

About this viewer

MolViewer shows 7QCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.