7QHP: I-Ag7 with a bound hybrid insulin peptide

Structure of I-Ag7 with a bound hybrid insulin peptide. Determined by X-ray diffraction at 1.82 Å resolution. Released 20 Jul 2022.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,252
Mol. weight: 51.06 kDa
Released: 20 Jul 2022

Explore 7QHP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QHP contains 12 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	1
β-strand	13-17	5	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	42-45	4	1
α-helix	48-53	6
β-strand	55	1	2
α-helix	58-78	21
α-helix	82-87	6
β-strand	90-95	6	3
β-strand	105-114	10	3
β-strand	120-125	6	4
β-strand	128-130	3	4
β-strand	135-136	2	3
β-strand	140-141	2	3
β-strand	147-155	9	3
β-strand	163-168	6	4
β-strand	176-180	5	4

Chain B: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	1
β-strand	23-32	10	1
β-strand	35-41	7	1
β-strand	46-49	4	1
α-helix	52-54	3
α-helix	55-72	18
α-helix	73-78	6
α-helix	79-80	2
α-helix	81-85	5
α-helix	89-91	3
β-strand	94	1	5
α-helix	95-96	2
β-strand	97-102	6	6
β-strand	113-121	9	6
β-strand	122	1	5
β-strand	127-132	6	7
β-strand	135-136	2	7
β-strand	141-143	3	6
α-helix	144-146	3
β-strand	147-148	2	6
β-strand	154-161	8	6
β-strand	169-175	7	7
β-strand	183-188	6	7

Chain T: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	0	1	2
α-helix	3-9	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, A-D alpha chain	A	protein	202	Mus musculus	P04228 (AlphaFold model)
Murine MHC class II I-A beta g7	B	protein	230	Mus musculus	Q31135 (AlphaFold model)
Insulin-1	T	protein	13	Mus musculus	P01325 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QHP_1 H-2 class II histocompatibility antigen, A-D alpha chain (chains A)
EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEP
QGGLQNIAAEKHNLGCLTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPV
INITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLK
HWEPEIPAPMSELTESLEVLFQ

Sequence of entity 2 (B), FASTA

>7QHP_2 Murine MHC class II I-A beta g7 (chains B)
LQTLALEVEDDPCGGGGGSGGGSGGSGDSERHFVHQFKGECYFTNGTQRIRLVTRYIYNR
EEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLE
QPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTF
QVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKSLEVLFQ

Sequence of entity 3 (T), FASTA

>7QHP_3 Insulin-1 (chains T)
LQTLALEVEDDPC

Primary citation

Structural plasticity in I-A g7 links autoreactivity to hybrid insulin peptides in type I diabetes. Erausquin, E., Serra, P., Parras, D. et al. Front Immunol (2022) 13:924311-924311. DOI 10.3389/fimmu.2022.924311 · PubMed

Other PDB entries of the same protein (UniProt P04228 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BLQ 1.8 Å, Crystal Structure of IAg7 in complex with insulin mimotope p8E9E
6BLR 1.96 Å, Crystal Structure of IAg7 in complex with insulin mimotope p8E9E6SS
6BLX 2.32 Å, Crystal structure of IAg7 in complex with insulin mimotope p8G9E
2IAD 2.4 Å, Class II MHC I-ad in complex with an influenza hemagglutinin peptide 126-138
5DMK 2.45 Å, Crystal Structure of IAg7 in complex with RLGL-WE14
1ES0 2.6 Å, Crystal structure of the murine class II allele I-A(G7) complexed with the glutamic acid…
1IAO 2.6 Å, Class II MHC I-ad in complex with ovalbumin peptide 323-339
7Z50 2.65 Å, Structure of the highly diabetogenic 4.1-T cell receptor targeting a hybrid insulin…
3MBE 2.89 Å, TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
7RDV 2.9 Å, TFH TCR bound to MHC Class II IAd presenting aggrecan epitope
3CUP 3.09 Å, Crystal structure of the MHC class II molecule I-Ag7 in complex with the peptide…
1F3J 3.1 Å, Histocompatibility antigen I-AG7

Browse structure collections

About this viewer

MolViewer shows 7QHP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.