7QIO: Myosin-4
Homology model of myosin neck domain in skeletal sarcomere. Determined by electron microscopy at 9.0 Å resolution. Released 16 Feb 2022.
- Method
- Electron microscopy
- Resolution
- 9.0 Å
- Organism
- Mus musculus
- Chains
- 6
- Atoms
- 5,424
- Mol. weight
- 272.01 kDa
- Released
- 16 Feb 2022
Explore 7QIO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7QIO contains 45 α-helices and 12 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain L: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 789-804 | 16 | |
| α-helix | 816-826 | 11 | |
| α-helix | 827-830 | 4 | |
| α-helix | 832-840 | 9 | |
Chain M: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 789-804 | 16 | |
| α-helix | 816-828 | 13 | |
| α-helix | 832-840 | 9 | |
Chain N: 10 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 43-56 | 14 | |
| β-strand | 64-65 | 2 | 1 |
| α-helix | 66-68 | 3 | |
| α-helix | 69-75 | 7 | |
| α-helix | 82-85 | 4 | |
| α-helix | 86-90 | 5 | |
| β-strand | 101-102 | 2 | 1 |
| α-helix | 104-115 | 12 | |
| α-helix | 123-131 | 9 | |
| β-strand | 140-141 | 2 | 2 |
| α-helix | 143-152 | 10 | |
| α-helix | 159-168 | 10 | |
| β-strand | 176-177 | 2 | 2 |
| α-helix | 178-186 | 9 | |
Chain O: 10 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 43-56 | 14 | |
| β-strand | 64-65 | 2 | 3 |
| α-helix | 66-68 | 3 | |
| α-helix | 69-75 | 7 | |
| α-helix | 82-87 | 6 | |
| α-helix | 97-99 | 3 | |
| β-strand | 101-102 | 2 | 3 |
| α-helix | 104-115 | 12 | |
| α-helix | 123-131 | 9 | |
| β-strand | 140-141 | 2 | 4 |
| α-helix | 143-152 | 10 | |
| α-helix | 159-168 | 10 | |
| β-strand | 176-177 | 2 | 4 |
| α-helix | 178-186 | 9 | |
Chain P: 9 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 24-37 | 14 | |
| α-helix | 47-53 | 7 | |
| α-helix | 60-63 | 4 | |
| α-helix | 64-71 | 8 | |
| α-helix | 80-86 | 7 | |
| α-helix | 97-105 | 9 | |
| α-helix | 117-126 | 10 | |
| α-helix | 133-140 | 8 | |
| β-strand | 145 | 1 | 5 |
| β-strand | 151 | 1 | 5 |
| α-helix | 153-161 | 9 | |
Chain Q: 9 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 24-37 | 14 | |
| α-helix | 47-53 | 7 | |
| α-helix | 60-63 | 4 | |
| α-helix | 64-71 | 8 | |
| α-helix | 80-86 | 7 | |
| α-helix | 97-105 | 9 | |
| α-helix | 117-125 | 9 | |
| α-helix | 133-140 | 8 | |
| β-strand | 145 | 1 | 6 |
| β-strand | 151 | 1 | 6 |
| α-helix | 153-161 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Myosin-4 | L, M | protein | 848 | Mus musculus | Q5SX39 (AlphaFold model) |
| Myosin light chain 1/3, skeletal muscle isoform | N, O | protein | 188 | Mus musculus | P05977 (AlphaFold model) |
| Myosin regulatory light chain 2, skeletal muscle isoform | P, Q | protein | 169 | Mus musculus | P97457 (AlphaFold model) |
Sequence of entity 1 (L, M), FASTA
>7QIO_1 Myosin-4 (chains L, M)
MSSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVDAKESYVKATVQSREGGKV
TAKTEGGATVTVKDDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGDKKKEEATSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPEL
IEMLLITTNPYDFAYVSQGEITVPSIDDQEELMATDTAVDILGFSADEKVAIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNSVGALAKSMYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNTLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKAEAHFSLVHYAGTVDYNIIGWLDKN
KDPLNETVVGLYQKSGLKTLAFLFSGGQAAEAEGGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLKSTHPHFVRCLIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGTLEEM
RDEKLAQLITRTQAVCRGYLMRVEFKKMMERRESIFCIQYNVRAFMNVKHWPWMKLYFKI
KPLLKSAE
Sequence of entity 2 (N, O), FASTA
>7QIO_2 Myosin light chain 1/3, skeletal muscle isoform (chains N, O)
MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTG
ECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQ
GGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEA
FVKHIMSV
Sequence of entity 3 (P, Q), FASTA
>7QIO_3 Myosin regulatory light chain 2, skeletal muscle isoform (chains P, Q)
MAPKKAKRRAGAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Primary citation
Structures from intact myofibrils reveal mechanism of thin filament regulation through nebulin. Wang, Z., Grange, M., Pospich, S. et al. Science (2022) 375:eabn1934-eabn1934. DOI 10.1126/science.abn1934 · PubMed
Other PDB entries of the same protein (UniProt Q5SX39 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7QIN 6.6 Å, In situ structure of actomyosin complex in skeletal sarcomere
- 7NEP 10.2 Å, Homology model of the in situ actomyosin complex from the A-band of mouse psoas muscle…
Browse structure collections
About this viewer
MolViewer shows 7QIO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.