7QNA: Human full-length alpha4beta3gamma2 GABA(A)R

Cryo-EM structure of human full-length alpha4beta3gamma2 GABA(A)R in complex with GABA and nanobody Nb25. Determined by electron microscopy at 3.0 Å resolution. Released 13 Apr 2022.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: Homo sapiens, Lama glama
Chains: 6
Atoms: 14,777
Mol. weight: 298.71 kDa
Ligands: NAG, ABU
Released: 13 Apr 2022

Explore 7QNA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QNA contains 67 α-helices and 74 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	49-56	8
α-helix	71	1
β-strand	72-87	16	1
β-strand	92-104	13	1
α-helix	106-108	3
β-strand	116-118	3	1
α-helix	121-126	6
β-strand	132-134	3	2
β-strand	137	1	1
β-strand	141-142	2	1
β-strand	150-155	6	1
β-strand	159-171	13	1
α-helix	176-178	3
β-strand	183-186	4	2
β-strand	189-192	4	2
β-strand	200-204	5	1
α-helix	208-211	4
β-strand	212-213	2	1
α-helix	216-218	3
β-strand	219	1	1
β-strand	224-237	14	2
β-strand	242-254	13	2
α-helix	257-259	3
α-helix	260-264	5
α-helix	265-279	15
α-helix	285-306	22
α-helix	311-312	2
α-helix	316-317	2
α-helix	318-347	30
α-helix	517-543	27

Chains B, D and E: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-51	16	3
β-strand	56-68	13	3
α-helix	70-72	3
β-strand	81-83	3	3
α-helix	85-90	6
β-strand	96-98	3	4
β-strand	101-106	6	3
β-strand	114-118	5	3
β-strand	123-135	13	3
β-strand	147-156	10	4
β-strand	164-168	5	3
α-helix	171-173	3
β-strand	175-176	2	3
α-helix	178-180	3
β-strand	186-200	15	4
β-strand	203-216	14	4
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-241	15
α-helix	247-269	23
α-helix	278-279	2
α-helix	280-306	27
α-helix	423-446	24

Chain C: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	28-35	8
α-helix	50	1
β-strand	51-66	16	5
β-strand	71-83	13	5
α-helix	85-87	3
β-strand	95-98	4	5
α-helix	100-105	6
β-strand	111-113	3	6
β-strand	116-121	6	5
β-strand	125	1	7
β-strand	129-134	6	5
β-strand	138-150	13	5
β-strand	162-171	10	6
β-strand	179-190	12	5
β-strand	201-214	14	6
β-strand	219-231	13	6
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-256	15
α-helix	262-283	22
α-helix	295-322	28
α-helix	410-434	25

Chain N: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	11
β-strand	405-413	9	11
α-helix	415-417	3
β-strand	420-426	7	12
β-strand	433-439	7	12
β-strand	447	1	12
β-strand	455-460	6	11
β-strand	465-470	6	11
α-helix	475-477	3
β-strand	479-486	8	12
β-strand	491	1	10
α-helix	496-498	3
β-strand	499-502	4	12
β-strand	506-508	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-4	A	protein	554	Homo sapiens	P48169 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3	B, D, E	protein	473	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	487	Homo sapiens	P18507 (AlphaFold model)
Nanobody Nb25	N	protein	121	Lama glama

Sequence of entity 1 (A), FASTA

>7QNA_1 Gamma-aminobutyric acid receptor subunit alpha-4 (chains A)
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM

Sequence of entity 2 (B, D, E), FASTA

>7QNA_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, D, E)
MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>7QNA_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGQKSDDDYEDYTSNKTWVLTPKVPEGDVTV
ILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKF
NSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDA
ECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNT
TEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLG
ITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKD
KDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLGTGGSGGSGGSTE
TSQVAPA

Sequence of entity 4 (N), FASTA

>7QNA_4 Nanobody Nb25 (chains N)
QVQLVESGGGLVQGSLRLSCAASGHTFNYPIMGWFRQAPGKEREFVGAISWSGGSTSYAD
SVKDRFTISRDNAKNTVYLEMNNLKPEDTAVYYCAAKGRYSGGLYYPTNYDYWGQGTQVT
V

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	1

Primary citation

Differential assembly diversifies GABA A receptor structures and signalling. Sente, A., Desai, R., Naydenova, K. et al. Nature (2022) 604:190-194. DOI 10.1038/s41586-022-04517-3 · PubMed

Other PDB entries of the same protein (UniProt P48169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QN5 2.5 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
9SL1 2.68 Å, GABA-A a4b3d receptor in complex with GABA, Nb24 and Mb30
7QN9 2.9 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
7QNC 2.9 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
7QN7 3.0 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
9SLD 3.04 Å, GABA-A a4b3d receptor in complex with DS2-Me, GABA, Nb24 and Mb30

Browse structure collections

About this viewer

MolViewer shows 7QNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.