7QTX: Bcl-2

Name: PDB 7QTX: Kaposi sarcoma associated herpes virus (KSHV) encoded apoptosis inhibitor, KsBcl-2 in complex with Puma BH3
Published: 2022-11-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Kaposi sarcoma associated herpes virus (KSHV) encoded apoptosis inhibitor, KsBcl-2 in complex with Puma BH3. Determined by X-ray diffraction at 2.12 Å resolution. Released 23 Nov 2022.

Method: X-ray diffraction
Resolution: 2.12 Å
Organisms: Human gammaherpesvirus 8, Homo sapiens
Chains: 2
Atoms: 1,419
Mol. weight: 20.27 kDa
Released: 23 Nov 2022

Explore 7QTX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QTX contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	9-16	8
α-helix	17-21	5
α-helix	33-46	14
α-helix	48-54	7
α-helix	63-76	14
α-helix	84-100	17
α-helix	105-123	19
α-helix	125-130	6
α-helix	133-144	12

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	134-153	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2	A	protein	151	Human gammaherpesvirus 8	Q76RI8
Bcl-2-binding component 3, isoforms 1/2	B	protein	26	Homo sapiens	Q9BXH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QTX_1 Bcl-2 (chains A)
GPLGSMDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLMRDKESLFEAML
ANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAILTFGSFVAQKLSNEPHLRDFALAVL
PAYAYEAIGPQWFRARGGWRGLKAYCTQVLT

Sequence of entity 2 (B), FASTA

>7QTX_2 Bcl-2-binding component 3, isoforms 1/2 (chains B)
EEQWAREIGAQLRRMADDLNAQYERR

Primary citation

Structural Insight into KsBcl-2 Mediated Apoptosis Inhibition by Kaposi Sarcoma Associated Herpes Virus. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Viruses (2022) 14. DOI 10.3390/v14040738 · PubMed

Other PDB entries of the same protein (UniProt Q76RI8), best resolution first:

7QTW 1.41 Å, Kaposi sarcoma associated herpes virus(KSHV) encoded apoptosis inhibitor, KsBcl-2 in…
1K3K Solution Structure of a Bcl-2 Homolog from Kaposi's Sarcoma Virus

Browse structure collections

About this viewer

MolViewer shows 7QTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.