7QU8: ADGRG3/GPR97 Extracellular Region

ADGRG3/GPR97 Extracellular Region. Determined by X-ray diffraction at 3.37 Å resolution. Released 28 Sept 2022.

Method: X-ray diffraction
Resolution: 3.37 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,640
Mol. weight: 121.05 kDa
Released: 28 Sept 2022

Explore 7QU8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QU8 contains 19 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	29-31	3
α-helix	41-48	8
α-helix	50-53	4
α-helix	64-80	17
β-strand	85-88	4	1
β-strand	92-100	9	1
β-strand	107-110	4	2
β-strand	119	1	2
α-helix	120-121	2
α-helix	125-127	3
β-strand	130-133	4	2
α-helix	135-140	6
β-strand	147-156	10	1
β-strand	175-176	2	1
α-helix	177-179	3
β-strand	180-183	4	1
β-strand	186	1	1
β-strand	193-202	10	2
α-helix	205-208	4
β-strand	212-219	8	1
β-strand	227-229	3	1
β-strand	231	1	3
β-strand	233-238	6	2
β-strand	241-248	8	2

Chain B: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	29-31	3
α-helix	41-48	8
α-helix	50-53	4
α-helix	64-80	17
β-strand	85-88	4	4
β-strand	92-100	9	4
α-helix	106	1
β-strand	107-110	4	5
β-strand	119	1	5
α-helix	120-121	2
α-helix	125-127	3
β-strand	130-133	4	5
α-helix	135-140	6
β-strand	147-156	10	4
β-strand	175-176	2	4
α-helix	177-179	3
β-strand	180-183	4	4
β-strand	186	1	4
β-strand	193-202	10	5
α-helix	205-208	4
β-strand	212-219	8	4
β-strand	227-229	3	4
β-strand	231	1	3
β-strand	233-238	6	5
β-strand	241-248	8	5

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	251-257	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adhesion G protein-coupled receptor G3	A, B, C, D	protein	272	Homo sapiens	Q86Y34 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7QU8_1 Adhesion G protein-coupled receptor G3 (chains A, B, C, D)
MATPRGLGALLLLLLLPTSGQEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSD
SCNVENLQRYWLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQV
MKDEDKPPDRVRLPKSLFRSLPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNR
LVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTTGDWSSEGCSTEVRPE
GTVCCCDHLTFFALLLRPTLDQSTTKHHHHHH

Primary citation

GPR97-mediated PAR2 transactivation via a mPR3-associated macromolecular complex induces inflammatory activation of human neutrophils. Chu, T.Y., Zheng-Gerard, C., Huang, K.Y. et al. Nat Commun (2022).

Other PDB entries of the same protein (UniProt Q86Y34 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D77 2.9 Å, Cryo-EM structure of the cortisol-bound adhesion receptor GPR97-Go complex
7D76 3.1 Å, Cryo-EM structure of the beclomethasone-bound adhesion receptor GPR97-Go complex

Browse structure collections

About this viewer

MolViewer shows 7QU8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.