Mus musculus acetylcholinesterase in complex with N-(3-(diethylamino)propyl)-4-methyl-3-nitrobenzamide. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 Apr 2022.
Explore 7R02 in 3D Show helices and sheets RCSB PDB PDBe
7R02 contains 72 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 9-12 | 4 | 1 |
| β-strand | 15-18 | 4 | 1 |
| β-strand | 20-24 | 5 | 2 |
| β-strand | 27-32 | 6 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 34-36 | 3 | 2 |
| β-strand | 38 | 1 | 4 |
| α-helix | 43-45 | 3 | |
| α-helix | 49-51 | 3 | |
| β-strand | 52 | 1 | 4 |
| α-helix | 53-55 | 3 | |
| β-strand | 59-61 | 3 | 1 |
| β-strand | 63 | 1 | 3 |
| α-helix | 67 | 1 | |
| β-strand | 68-69 | 2 | 5 |
| α-helix | 81-84 | 4 | |
| β-strand | 92-93 | 2 | 5 |
| β-strand | 98-104 | 7 | 2 |
| α-helix | 107-108 | 2 | |
| β-strand | 112-118 | 7 | 2 |
| α-helix | 131-133 | 3 | |
| α-helix | 136-137 | 2 | |
| α-helix | 138-142 | 5 | |
| β-strand | 145-149 | 5 | 2 |
| α-helix | 154-158 | 5 | |
| α-helix | 171-186 | 16 | |
| α-helix | 187-190 | 4 | |
| β-strand | 192-202 | 11 | 2 |
| α-helix | 204-214 | 11 | |
| α-helix | 216-219 | 4 | |
| β-strand | 224-228 | 5 | 2 |
| β-strand | 239 | 1 | 6 |
| α-helix | 241-254 | 14 | |
| α-helix | 266-274 | 9 | |
| α-helix | 278-285 | 8 | |
| α-helix | 286-288 | 3 | |
| β-strand | 302 | 1 | 6 |
| α-helix | 312-318 | 7 | |
| β-strand | 325-331 | 7 | 2 |
| β-strand | 333 | 1 | 7 |
| α-helix | 336-339 | 4 | |
| α-helix | 356-366 | 11 | |
| α-helix | 372-382 | 11 | |
| α-helix | 391-403 | 13 | |
| α-helix | 404-408 | 5 | |
| α-helix | 409-420 | 12 | |
| β-strand | 424-430 | 7 | 2 |
| α-helix | 432-434 | 3 | |
| α-helix | 441-443 | 3 | |
| β-strand | 446 | 1 | 7 |
| α-helix | 451-454 | 4 | |
| α-helix | 457-459 | 3 | |
| α-helix | 461-463 | 3 | |
| α-helix | 467-486 | 20 | |
| α-helix | 498-499 | 2 | |
| α-helix | 501-502 | 2 | |
| β-strand | 503 | 1 | 2 |
| β-strand | 509-513 | 5 | 2 |
| α-helix | 517-518 | 2 | |
| β-strand | 519-522 | 4 | 2 |
| α-helix | 526-530 | 5 | |
| α-helix | 531-535 | 5 | |
| α-helix | 536-542 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 9-12 | 4 | 8 |
| β-strand | 15-18 | 4 | 8 |
| β-strand | 20-24 | 5 | 9 |
| β-strand | 27-32 | 6 | 9 |
| β-strand | 33 | 1 | 10 |
| β-strand | 34-36 | 3 | 9 |
| β-strand | 38 | 1 | 11 |
| α-helix | 43-45 | 3 | |
| α-helix | 49-50 | 2 | |
| β-strand | 52 | 1 | 11 |
| α-helix | 53-55 | 3 | |
| β-strand | 59-61 | 3 | 8 |
| β-strand | 63 | 1 | 10 |
| α-helix | 67 | 1 | |
| β-strand | 68-69 | 2 | 12 |
| α-helix | 81-84 | 4 | |
| β-strand | 92-93 | 2 | 12 |
| β-strand | 98-104 | 7 | 9 |
| α-helix | 107-108 | 2 | |
| β-strand | 112-118 | 7 | 9 |
| α-helix | 131-133 | 3 | |
| α-helix | 136-142 | 7 | |
| β-strand | 145-149 | 5 | 9 |
| α-helix | 154-158 | 5 | |
| α-helix | 171-186 | 16 | |
| α-helix | 187-190 | 4 | |
| β-strand | 192-202 | 11 | 9 |
| α-helix | 204-213 | 10 | |
| α-helix | 216-219 | 4 | |
| β-strand | 224-228 | 5 | 9 |
| β-strand | 239 | 1 | 13 |
| α-helix | 241-254 | 14 | |
| α-helix | 266-274 | 9 | |
| α-helix | 278-285 | 8 | |
| β-strand | 302 | 1 | 13 |
| α-helix | 312-318 | 7 | |
| β-strand | 325-331 | 7 | 9 |
| β-strand | 333 | 1 | 14 |
| α-helix | 336-339 | 4 | |
| α-helix | 356-366 | 11 | |
| α-helix | 372-382 | 11 | |
| α-helix | 391-403 | 13 | |
| α-helix | 404-408 | 5 | |
| α-helix | 409-420 | 12 | |
| β-strand | 424-430 | 7 | 9 |
| α-helix | 432-434 | 3 | |
| α-helix | 441-443 | 3 | |
| β-strand | 446 | 1 | 14 |
| α-helix | 451-454 | 4 | |
| α-helix | 457-459 | 3 | |
| α-helix | 461-463 | 3 | |
| α-helix | 467-486 | 20 | |
| α-helix | 501-503 | 3 | |
| β-strand | 509-513 | 5 | 9 |
| β-strand | 519-522 | 4 | 9 |
| α-helix | 526-530 | 5 | |
| α-helix | 531-535 | 5 | |
| α-helix | 536-542 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Acetylcholinesterase | A, B | protein | 543 | Mus musculus | P21836 (AlphaFold model) |
>7R02_1 Acetylcholinesterase (chains A, B) EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVL DATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYG GGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLAL QWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFV PVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFL AGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAA QGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLL SAT
| ID | Name | Formula | Copies |
|---|---|---|---|
| 9YU | 2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol | C15 H32 O8 | 1 |
| PG0 | 2-(2-methoxyethoxy)ethanol | C5 H12 O3 | 11 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
| I62 | N-[(2E)-3-(diethylamino)prop-2-en-1-yl]-4-methyl-3-nitrobenzamide | C15 H21 N3 O3 | 2 |
Water and common crystallization additives (EDO) are not listed.
Broad-Spectrum Antidote Discovery by Untangling the Reactivation Mechanism of Nerve-Agent-Inhibited Acetylcholinesterase. Lindgren, C., Forsgren, N., Hoster, N. et al. Chemistry (2022) 28:e202200678-e202200678. DOI 10.1002/chem.202200678 · PubMed
Other PDB entries of the same protein (UniProt P21836 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7R02 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.