7RAZ: Small conductance mechanosensitive channel MscS

Small conductance mechanosensitive channel MscS. Determined by electron microscopy at 3.4 Å resolution. Released 13 Jul 2022.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Escherichia coli 'BL21-Gold(DE3)pLysS AG'
Chains: 7
Atoms: 10,472
Mol. weight: 221.6 kDa
Ligands: PTY
Released: 13 Jul 2022

Explore 7RAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RAZ contains 31 α-helices and 76 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	95-127	33
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	2
α-helix	198-211	14
β-strand	222-228	7	2
β-strand	233-242	10	2
α-helix	246-264	19
β-strand	272	1	3
β-strand	274-277	4	4

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	95-127	33
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	5
α-helix	198-211	14
β-strand	215	1	5
β-strand	221-228	8	5
β-strand	233-242	10	5
α-helix	246-264	19
β-strand	272-275	4	4

Chain C: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	93-127	35
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	6
α-helix	198-211	14
β-strand	215	1	6
β-strand	221-228	8	6
β-strand	233-242	10	6
α-helix	246-264	19
α-helix	268-270	3
β-strand	272	1	4
β-strand	274	1	7

Chain D: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	93-127	35
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	8
α-helix	198-211	14
β-strand	215	1	8
β-strand	221-228	8	8
β-strand	233-242	10	8
α-helix	246-264	19
β-strand	272	1	7
β-strand	274	1	9
β-strand	279	1	10

Chain E: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	95-127	33
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	11
α-helix	198-211	14
β-strand	215	1	11
β-strand	222-228	7	11
β-strand	233-242	10	11
α-helix	246-264	19
α-helix	269-271	3
β-strand	272	1	9
β-strand	274	1	12
β-strand	277	1	10

Chain F: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	93-127	35
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	13
α-helix	198-211	14
β-strand	215	1	13
β-strand	221-228	8	13
β-strand	233-242	10	13
α-helix	246-264	19
α-helix	269-271	3
β-strand	272	1	12

Chain G: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	95-127	33
β-strand	135-138	4	1
β-strand	141-148	8	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-172	6
β-strand	175-177	3	1
β-strand	183-192	10	14
α-helix	198-211	14
β-strand	215	1	14
β-strand	222-228	7	14
β-strand	233-242	10	14
α-helix	246-264	19
β-strand	274	1	3
β-strand	279	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small-conductance mechanosensitive channel	A, B, C, D, E, F, G	protein	286	Escherichia coli 'BL21-Gold(DE3)pLysS AG'	P0C0S1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>7RAZ_1 Small-conductance mechanosensitive channel (chains A, B, C, D, E, F, G)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Ligands and cofactors

ID	Name	Formula	Copies
PTY	Phosphatidylethanolamine	C40 H80 N O8 P	7

Primary citation

Small conductance mechanosensitive channel MscS. Catalano, C., Ben-Hail, D., Qiu, W. et al. To be published.

Other PDB entries of the same protein (UniProt P0C0S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ONJ 2.3 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation
9E68 2.5 Å, Cryo-EM structure of MscS/YnaI chimera in DOPC nanodiscs
7OOA 2.7 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation with added lipid
9H2S 2.7 Å, a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids…
9H2V 2.8 Å, a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets
6RLD 2.9 Å, Structure of the mechanosensitive channel mscs embedded in the membrane bilayer
5AJI 2.99 Å, MscS D67R1 high resolution
6PWN 3.1 Å, MscS Nanodisc with N-terminal His-Tag
7OO0 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in open conformation
7OO6 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in closed conformation with added lipid
8DDJ 3.1 Å, Open MscS in PC14.1 Nanodiscs
6VYK 3.2 Å, Cryo-EM structure of mechanosensitive channel MscS in PC-18:1 nanodiscs

Browse structure collections

About this viewer

MolViewer shows 7RAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.