7RF6: Photosystem II protein D1 1

RT XFEL structure of Photosystem II 250 microseconds after the second illumination at 2.01 Angstrom resolution. Determined by X-ray diffraction at 2.01 Å resolution. Released 10 Nov 2021.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Thermosynechococcus elongatus (strain BP-1)
Chains: 40
Atoms: 53,366
Mol. weight: 759.05 kDa
Ligands: OEY, PHO, PL9, LMG
Released: 10 Nov 2021

Explore 7RF6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RF6 contains 301 α-helices and 179 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 23 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
α-helix	31-54	24
α-helix	55-57	3
β-strand	58	1	45
α-helix	66	1
β-strand	67	1	45
α-helix	68	1
α-helix	71-73	3
β-strand	81-82	2	46
α-helix	83-86	4
α-helix	96-98	3
α-helix	102-107	6
α-helix	110-136	27
α-helix	143-155	13
α-helix	156-160	5
α-helix	161-165	5
α-helix	168-170	3
α-helix	172-173	2
β-strand	174-175	2	46
α-helix	176-190	15
α-helix	192-194	3
α-helix	196-220	25
β-strand	223	1	47
β-strand	224	1	48
α-helix	233-236	4
β-strand	243	1	49
β-strand	246	1	47
α-helix	248-258	11
α-helix	261-263	3
α-helix	268-293	26
β-strand	297-298	2	50
β-strand	307	1	51
β-strand	313	1	51
α-helix	317-331	15

Chain A: 21 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
α-helix	31-54	24
α-helix	55-57	3
β-strand	58	1	1
β-strand	67	1	1
α-helix	71-73	3
β-strand	81-82	2	2
α-helix	83-86	4
α-helix	96-98	3
α-helix	102-108	7
α-helix	110-137	28
α-helix	143-155	13
α-helix	156-160	5
α-helix	161-165	5
α-helix	168-170	3
α-helix	172-173	2
β-strand	174-175	2	2
α-helix	176-190	15
α-helix	192-194	3
α-helix	196-221	26
β-strand	223	1	3
β-strand	224	1	4
α-helix	233-236	4
β-strand	243	1	5
β-strand	246	1	3
α-helix	248-258	11
α-helix	261-263	3
α-helix	268-293	26
β-strand	297-298	2	6
β-strand	307	1	7
β-strand	313	1	7
α-helix	317-331	15

Chain b: 27 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	52
α-helix	5-12	8
α-helix	16-44	29
α-helix	55-58	4
α-helix	63-68	6
β-strand	73	1	53
β-strand	78	1	54
β-strand	79	1	53
β-strand	84	1	54
α-helix	93-116	24
β-strand	120	1	55
α-helix	121-123	3
β-strand	124	1	56
β-strand	131	1	56
α-helix	135-152	18
α-helix	153-158	6
β-strand	166-168	3	57
β-strand	177-179	3	57
α-helix	187-190	4
α-helix	195-218	24
α-helix	220-221	2
β-strand	222	1	58
α-helix	223-228	6
α-helix	234-258	25
α-helix	265-268	4
α-helix	272-276	5
α-helix	279-292	14
α-helix	298-303	6
α-helix	307-312	6
β-strand	314	1	59
α-helix	315-317	3
β-strand	323	1	60
α-helix	330-332	3
β-strand	336-342	7	61
β-strand	343-347	5	62
β-strand	353-354	2	62
β-strand	355-356	2	63
α-helix	357-360	4
β-strand	369-371	3	63
β-strand	377-380	4	63
β-strand	391	1	63
α-helix	392-395	4
β-strand	398-402	5	62
β-strand	410-411	2	62
α-helix	414-424	11
β-strand	427	1	59
β-strand	429-433	5	61
α-helix	447-474	28
α-helix	476-478	3
β-strand	482	1	48
α-helix	488-491	4
β-strand	496	1	64
β-strand	498	1	65
α-helix	502-504	3
β-strand	505	1	64

Chain B: 27 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	8
α-helix	5-12	8
α-helix	16-44	29
α-helix	55-58	4
α-helix	63-68	6
β-strand	73	1	9
β-strand	78	1	10
β-strand	79	1	9
β-strand	84	1	10
α-helix	93-116	24
β-strand	120	1	11
α-helix	121-123	3
β-strand	124	1	12
β-strand	131	1	12
α-helix	135-152	18
α-helix	153-158	6
β-strand	166-168	3	13
β-strand	177-179	3	13
α-helix	187-190	4
α-helix	195-218	24
α-helix	220-221	2
β-strand	222	1	14
α-helix	223-228	6
α-helix	234-258	25
α-helix	265-268	4
α-helix	272-276	5
α-helix	279-293	15
α-helix	298-303	6
α-helix	307-312	6
β-strand	314	1	15
α-helix	315-317	3
β-strand	323	1	16
α-helix	330-332	3
β-strand	336-342	7	17
β-strand	343-347	5	18
β-strand	353-354	2	18
β-strand	355-356	2	19
α-helix	357-360	4
β-strand	369-371	3	19
β-strand	377-380	4	19
α-helix	392-395	4
β-strand	398-402	5	18
β-strand	410-411	2	18
α-helix	414-424	11
β-strand	427	1	15
β-strand	429-433	5	17
α-helix	447-474	28
α-helix	476-478	3
β-strand	482	1	4
α-helix	488-491	4
β-strand	496	1	20
β-strand	498	1	21
α-helix	502-504	3
β-strand	505	1	20

Chain c: 26 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-31	4
α-helix	35-42	8
α-helix	46-73	28
α-helix	81-83	3
α-helix	89-94	6
β-strand	99	1	66
α-helix	101-103	3
β-strand	105	1	66
α-helix	109-130	22
α-helix	131-135	5
α-helix	154-180	27
β-strand	185-187	3	67
β-strand	195-197	3	67
α-helix	206-209	4
α-helix	211-214	4
α-helix	223-226	4
α-helix	230-253	24
α-helix	258-263	6
α-helix	268-292	25
α-helix	299-302	4
α-helix	306-324	19
β-strand	332	1	68
β-strand	338	1	68
β-strand	341-343	3	69
β-strand	349-351	3	69
α-helix	353-358	6
α-helix	367-369	3
β-strand	370-371	2	69
β-strand	374-375	2	69
α-helix	377-382	6
α-helix	386-396	11
β-strand	402-403	2	50
β-strand	407	1	70
β-strand	408	1	50
α-helix	413-414	2
β-strand	418	1	70
α-helix	422-453	32
β-strand	459	1	71
α-helix	461-463	3
α-helix	465-468	4
α-helix	470-471	2

Chain C: 23 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	35-42	8
α-helix	46-74	29
α-helix	81-83	3
α-helix	89-94	6
β-strand	99	1	22
α-helix	101-103	3
β-strand	105	1	22
α-helix	109-130	22
α-helix	131-135	5
α-helix	154-181	28
β-strand	185-187	3	23
β-strand	195-197	3	23
α-helix	206-213	8
α-helix	223-226	4
α-helix	230-253	24
α-helix	258-261	4
α-helix	268-292	25
α-helix	299-302	4
α-helix	306-323	18
β-strand	332	1	24
β-strand	338	1	24
β-strand	341-343	3	25
β-strand	349-351	3	25
α-helix	353-358	6
α-helix	367-369	3
β-strand	370-371	2	25
β-strand	374-375	2	25
α-helix	377-382	6
α-helix	386-396	11
β-strand	402-403	2	6
β-strand	407	1	26
β-strand	408	1	6
α-helix	413-414	2
β-strand	418	1	26
α-helix	422-453	32
β-strand	459	1	27
α-helix	461-463	3
α-helix	465-468	4

Chain d: 24 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
β-strand	24	1	65
α-helix	31-54	24
β-strand	57	1	72
α-helix	58-61	4
β-strand	63	1	72
α-helix	67-69	3
β-strand	77-78	2	73
α-helix	79-82	4
α-helix	83-85	3
α-helix	101-107	7
α-helix	109-136	28
α-helix	141-145	5
α-helix	147-153	7
α-helix	154-159	6
α-helix	160-163	4
α-helix	167-169	3
β-strand	173-174	2	73
α-helix	175-184	10
α-helix	185-189	5
α-helix	191-193	3
α-helix	195-219	25
β-strand	222	1	74
β-strand	223	1	71
α-helix	231-234	4
β-strand	241	1	49
β-strand	244	1	74
α-helix	246-257	12
α-helix	264-290	27
β-strand	294	1	60
α-helix	299-307	9
α-helix	314-333	20
α-helix	335-337	3
α-helix	343-345	3

Chain D: 23 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
β-strand	24	1	21
α-helix	31-54	24
β-strand	57	1	28
α-helix	58-61	4
β-strand	63	1	28
α-helix	67-69	3
β-strand	77-78	2	29
α-helix	79-82	4
α-helix	83-85	3
α-helix	101-106	6
α-helix	109-136	28
α-helix	141-153	13
α-helix	154-159	6
α-helix	160-163	4
α-helix	167-169	3
α-helix	171-172	2
β-strand	173-174	2	29
α-helix	175-189	15
α-helix	191-193	3
α-helix	195-219	25
β-strand	222	1	30
β-strand	223	1	27
α-helix	231-234	4
β-strand	241	1	5
β-strand	244	1	30
α-helix	246-257	12
α-helix	264-290	27
β-strand	294	1	16
α-helix	299-307	9
α-helix	314-333	20
α-helix	335-337	3
α-helix	343-345	3

28 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Photosystem II protein D1 1	A, a	protein	344	Thermosynechococcus elongatus (strain BP-1)	P0A444 (AlphaFold model)
Photosystem II CP47 reaction center protein	B, b	protein	510	Thermosynechococcus elongatus (strain BP-1)	Q8DIQ1 (AlphaFold model)
Photosystem II CP43 reaction center protein	C, c	protein	461	Thermosynechococcus elongatus (strain BP-1)	Q8DIF8 (AlphaFold model)
Photosystem II D2 protein	D, d	protein	352	Thermosynechococcus elongatus (strain BP-1)	Q8CM25 (AlphaFold model)
Cytochrome b559 subunit alpha	E, e	protein	84	Thermosynechococcus elongatus (strain BP-1)	Q8DIP0
Cytochrome b559 subunit beta	F, f	protein	45	Thermosynechococcus elongatus (strain BP-1)	Q8DIN9
Photosystem II reaction center protein H	H, h	protein	66	Thermosynechococcus elongatus (strain BP-1)	Q8DJ43
Photosystem II reaction center protein I	I, i	protein	38	Thermosynechococcus elongatus (strain BP-1)	Q8DJZ6
Photosystem II reaction center protein J	J, j	protein	40	Thermosynechococcus elongatus (strain BP-1)	P59087
Photosystem II reaction center protein K	K, k	protein	46	Thermosynechococcus elongatus (strain BP-1)	Q9F1K9
Photosystem II reaction center protein L	L, l	protein	37	Thermosynechococcus elongatus (strain BP-1)	Q8DIN8
Photosystem II reaction center protein M	M, m	protein	36	Thermosynechococcus elongatus (strain BP-1)	Q8DHA7

8 more molecules are not listed.

Sequence of entity 1 (A, a), FASTA

>7RF6_1 Photosystem II protein D1 1 (chains A, a)
MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI
DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL
LGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGF
NFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA

Sequence of entity 2 (B, b), FASTA

>7RF6_2 Photosystem II CP47 reaction center protein (chains B, b)
MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGM
FVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDL
ELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQP
VAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEE
AWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMP
AFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSY
ARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRRKEAV

Sequence of entity 3 (C, c), FASTA

>7RF6_3 Photosystem II CP43 reaction center protein (chains C, c)
MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEL
AHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYH
AIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPG
GGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHI
LTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQA
QAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFV
LAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD

Sequence of entity 4 (D, d), FASTA

>7RF6_4 Photosystem II D2 protein (chains D, d)
MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAF
GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFR
FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFIS
QEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

Sequence of entity 5 (E, e), FASTA

>7RF6_5 Cytochrome b559 subunit alpha (chains E, e)
MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQ
RSIPLVTDRFEAKQQVETFLEQLK

Sequence of entity 6 (F, f), FASTA

>7RF6_6 Cytochrome b559 subunit beta (chains F, f)
MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

Sequence of entity 7 (H, h), FASTA

>7RF6_7 Photosystem II reaction center protein H (chains H, h)
MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNV
SWKALG

Sequence of entity 8 (I, i), FASTA

>7RF6_8 Photosystem II reaction center protein I (chains I, i)
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE

Sequence of entity 9 (J, j), FASTA

>7RF6_9 Photosystem II reaction center protein J (chains J, j)
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL

Sequence of entity 10 (K, k), FASTA

>7RF6_10 Photosystem II reaction center protein K (chains K, k)
MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR

Sequence of entity 11 (L, l), FASTA

>7RF6_11 Photosystem II reaction center protein L (chains L, l)
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN

Sequence of entity 12 (M, m), FASTA

>7RF6_12 Photosystem II reaction center protein M (chains M, m)
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS

Ligands and cofactors

ID	Name	Formula	Copies
OEY	Ca-MN4-O6 cluster	Ca Mn4 O6	2
PHO	Pheophytin a	C55 H74 N4 O5	4
PL9	2,3-dimethyl-5-(3,7,11,15,19,23,27,31,35-nonamethyl-2,6,10,14,18,22,26,30,34-he…	C53 H80 O2	4
LMG	1,2-distearoyl-monogalactosyl-diglyceride	C45 H86 O10	13
DGD	Digalactosyl diacyl glycerol (DGDG)	C51 H96 O15	9
BCT	Bicarbonate ion	C H O3	2
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2
HEC	Heme C	C34 H36 Fe N4 O4	2
STE	Stearic acid	C18 H36 O2	35
SQD	1,2-di-O-acyl-3-O-[6-deoxy-6-sulfo-alpha-D-glucopyranosyl]-sn-glycerol	C41 H78 O12 S	8
LHG	1,2-dipalmitoyl-phosphatidyl-glycerole	C38 H75 O10 P	10
BCR	Beta-carotene	C40 H56	22
CLA	Chlorophyll a	C55 H72 Mg N4 O5	70
FE2	FE (II) ion	Fe	2
OEX	Ca-MN4-O5 cluster	Ca Mn4 O5	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition. Hussein, R., Ibrahim, M., Bhowmick, A. et al. Nat Commun (2021) 12:6531-6531. DOI 10.1038/s41467-021-26781-z · PubMed

Other PDB entries of the same protein (UniProt P0A444 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OJ5 1.08 Å, YCF48 bound to D1 peptide
9EVX 1.71 Å, cryoEM structure of Photosystem II averaged across S2-S3 states at 1.71 Angstrom…
7RF1 1.89 Å, RT XFEL structure of Photosystem II averaged across all S-states at 1.89 Angstrom…
9Z35 1.93 Å, RT XFEL structure of two-flash state of Photosystem II (2F, S3 rich) at 1.93 Angstrom…
9Z6A 1.93 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3 rich) at 1.93…
9Z33 1.97 Å, RT XFEL structure of dark-stable state of Photosystem II (0F, S1 rich) at 1.97 Angstrom…
9Z68 1.97 Å, RT XFEL structure of the dark-stable state of Photosystem II (0F, S1 rich) at 1.97…
9Z34 1.98 Å, RT XFEL structure of one-flash state of Photosystem II (1F, S2 rich) at 1.98 Angstrom…
9Z69 1.98 Å, RT XFEL structure of the one-flash state of Photosystem II (1F, S2 rich) at 1.98…
8F4C 2.0 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.00…
8F4I 2.0 Å, RT XFEL structure of Photosystem II 2000 microseconds after the third illumination at…
8F4J 2.0 Å, RT XFEL structure of Photosystem II 4000 microseconds after the third illumination at…

Browse structure collections

About this viewer

MolViewer shows 7RF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.