7RF6: Photosystem II protein D1 1
RT XFEL structure of Photosystem II 250 microseconds after the second illumination at 2.01 Angstrom resolution. Determined by X-ray diffraction at 2.01 Å resolution. Released 10 Nov 2021.
- Method
- X-ray diffraction
- Resolution
- 2.01 Å
- Organism
- Thermosynechococcus elongatus (strain BP-1)
- Chains
- 40
- Atoms
- 53,366
- Mol. weight
- 759.05 kDa
- Ligands
- OEY, PHO, PL9, LMG
- Released
- 10 Nov 2021
Explore 7RF6 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7RF6 contains 301 α-helices and 179 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 23 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 31-54 | 24 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58 | 1 | 45 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 45 |
| α-helix | 68 | 1 | |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 46 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-107 | 6 | |
| α-helix | 110-136 | 27 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 46 |
| α-helix | 176-190 | 15 | |
| α-helix | 192-194 | 3 | |
| α-helix | 196-220 | 25 | |
| β-strand | 223 | 1 | 47 |
| β-strand | 224 | 1 | 48 |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 49 |
| β-strand | 246 | 1 | 47 |
| α-helix | 248-258 | 11 | |
| α-helix | 261-263 | 3 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 50 |
| β-strand | 307 | 1 | 51 |
| β-strand | 313 | 1 | 51 |
| α-helix | 317-331 | 15 | |
Chain A: 21 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 31-54 | 24 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58 | 1 | 1 |
| β-strand | 67 | 1 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 2 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-108 | 7 | |
| α-helix | 110-137 | 28 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 2 |
| α-helix | 176-190 | 15 | |
| α-helix | 192-194 | 3 | |
| α-helix | 196-221 | 26 | |
| β-strand | 223 | 1 | 3 |
| β-strand | 224 | 1 | 4 |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 5 |
| β-strand | 246 | 1 | 3 |
| α-helix | 248-258 | 11 | |
| α-helix | 261-263 | 3 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 6 |
| β-strand | 307 | 1 | 7 |
| β-strand | 313 | 1 | 7 |
| α-helix | 317-331 | 15 | |
Chain b: 27 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 52 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-58 | 4 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 53 |
| β-strand | 78 | 1 | 54 |
| β-strand | 79 | 1 | 53 |
| β-strand | 84 | 1 | 54 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 55 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 56 |
| β-strand | 131 | 1 | 56 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 57 |
| β-strand | 177-179 | 3 | 57 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 58 |
| α-helix | 223-228 | 6 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-292 | 14 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 59 |
| α-helix | 315-317 | 3 | |
| β-strand | 323 | 1 | 60 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 61 |
| β-strand | 343-347 | 5 | 62 |
| β-strand | 353-354 | 2 | 62 |
| β-strand | 355-356 | 2 | 63 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 63 |
| β-strand | 377-380 | 4 | 63 |
| β-strand | 391 | 1 | 63 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 62 |
| β-strand | 410-411 | 2 | 62 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 59 |
| β-strand | 429-433 | 5 | 61 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 48 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 64 |
| β-strand | 498 | 1 | 65 |
| α-helix | 502-504 | 3 | |
| β-strand | 505 | 1 | 64 |
Chain B: 27 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 8 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-58 | 4 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 9 |
| β-strand | 78 | 1 | 10 |
| β-strand | 79 | 1 | 9 |
| β-strand | 84 | 1 | 10 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 11 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 12 |
| β-strand | 131 | 1 | 12 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 13 |
| β-strand | 177-179 | 3 | 13 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 14 |
| α-helix | 223-228 | 6 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-293 | 15 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 15 |
| α-helix | 315-317 | 3 | |
| β-strand | 323 | 1 | 16 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 17 |
| β-strand | 343-347 | 5 | 18 |
| β-strand | 353-354 | 2 | 18 |
| β-strand | 355-356 | 2 | 19 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 19 |
| β-strand | 377-380 | 4 | 19 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 18 |
| β-strand | 410-411 | 2 | 18 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 15 |
| β-strand | 429-433 | 5 | 17 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 4 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 20 |
| β-strand | 498 | 1 | 21 |
| α-helix | 502-504 | 3 | |
| β-strand | 505 | 1 | 20 |
Chain c: 26 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-31 | 4 | |
| α-helix | 35-42 | 8 | |
| α-helix | 46-73 | 28 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 66 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 66 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-180 | 27 | |
| β-strand | 185-187 | 3 | 67 |
| β-strand | 195-197 | 3 | 67 |
| α-helix | 206-209 | 4 | |
| α-helix | 211-214 | 4 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-263 | 6 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-324 | 19 | |
| β-strand | 332 | 1 | 68 |
| β-strand | 338 | 1 | 68 |
| β-strand | 341-343 | 3 | 69 |
| β-strand | 349-351 | 3 | 69 |
| α-helix | 353-358 | 6 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 69 |
| β-strand | 374-375 | 2 | 69 |
| α-helix | 377-382 | 6 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 50 |
| β-strand | 407 | 1 | 70 |
| β-strand | 408 | 1 | 50 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 70 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 71 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
| α-helix | 470-471 | 2 | |
Chain C: 23 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-42 | 8 | |
| α-helix | 46-74 | 29 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 22 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 22 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-181 | 28 | |
| β-strand | 185-187 | 3 | 23 |
| β-strand | 195-197 | 3 | 23 |
| α-helix | 206-213 | 8 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-261 | 4 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-323 | 18 | |
| β-strand | 332 | 1 | 24 |
| β-strand | 338 | 1 | 24 |
| β-strand | 341-343 | 3 | 25 |
| β-strand | 349-351 | 3 | 25 |
| α-helix | 353-358 | 6 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 25 |
| β-strand | 374-375 | 2 | 25 |
| α-helix | 377-382 | 6 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 6 |
| β-strand | 407 | 1 | 26 |
| β-strand | 408 | 1 | 6 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 26 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 27 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
Chain d: 24 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 65 |
| α-helix | 31-54 | 24 | |
| β-strand | 57 | 1 | 72 |
| α-helix | 58-61 | 4 | |
| β-strand | 63 | 1 | 72 |
| α-helix | 67-69 | 3 | |
| β-strand | 77-78 | 2 | 73 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-107 | 7 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-145 | 5 | |
| α-helix | 147-153 | 7 | |
| α-helix | 154-159 | 6 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| β-strand | 173-174 | 2 | 73 |
| α-helix | 175-184 | 10 | |
| α-helix | 185-189 | 5 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-219 | 25 | |
| β-strand | 222 | 1 | 74 |
| β-strand | 223 | 1 | 71 |
| α-helix | 231-234 | 4 | |
| β-strand | 241 | 1 | 49 |
| β-strand | 244 | 1 | 74 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 60 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
Chain D: 23 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 21 |
| α-helix | 31-54 | 24 | |
| β-strand | 57 | 1 | 28 |
| α-helix | 58-61 | 4 | |
| β-strand | 63 | 1 | 28 |
| α-helix | 67-69 | 3 | |
| β-strand | 77-78 | 2 | 29 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-106 | 6 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-153 | 13 | |
| α-helix | 154-159 | 6 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-172 | 2 | |
| β-strand | 173-174 | 2 | 29 |
| α-helix | 175-189 | 15 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-219 | 25 | |
| β-strand | 222 | 1 | 30 |
| β-strand | 223 | 1 | 27 |
| α-helix | 231-234 | 4 | |
| β-strand | 241 | 1 | 5 |
| β-strand | 244 | 1 | 30 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 16 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
28 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Photosystem II protein D1 1 | A, a | protein | 344 | Thermosynechococcus elongatus (strain BP-1) | P0A444 (AlphaFold model) |
| Photosystem II CP47 reaction center protein | B, b | protein | 510 | Thermosynechococcus elongatus (strain BP-1) | Q8DIQ1 (AlphaFold model) |
| Photosystem II CP43 reaction center protein | C, c | protein | 461 | Thermosynechococcus elongatus (strain BP-1) | Q8DIF8 (AlphaFold model) |
| Photosystem II D2 protein | D, d | protein | 352 | Thermosynechococcus elongatus (strain BP-1) | Q8CM25 (AlphaFold model) |
| Cytochrome b559 subunit alpha | E, e | protein | 84 | Thermosynechococcus elongatus (strain BP-1) | Q8DIP0 |
| Cytochrome b559 subunit beta | F, f | protein | 45 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN9 |
| Photosystem II reaction center protein H | H, h | protein | 66 | Thermosynechococcus elongatus (strain BP-1) | Q8DJ43 |
| Photosystem II reaction center protein I | I, i | protein | 38 | Thermosynechococcus elongatus (strain BP-1) | Q8DJZ6 |
| Photosystem II reaction center protein J | J, j | protein | 40 | Thermosynechococcus elongatus (strain BP-1) | P59087 |
| Photosystem II reaction center protein K | K, k | protein | 46 | Thermosynechococcus elongatus (strain BP-1) | Q9F1K9 |
| Photosystem II reaction center protein L | L, l | protein | 37 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN8 |
| Photosystem II reaction center protein M | M, m | protein | 36 | Thermosynechococcus elongatus (strain BP-1) | Q8DHA7 |
8 more molecules are not listed.
Sequence of entity 1 (A, a), FASTA
>7RF6_1 Photosystem II protein D1 1 (chains A, a)
MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI
DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL
LGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGF
NFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Sequence of entity 2 (B, b), FASTA
>7RF6_2 Photosystem II CP47 reaction center protein (chains B, b)
MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGM
FVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDL
ELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQP
VAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEE
AWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMP
AFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSY
ARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRRKEAV
Sequence of entity 3 (C, c), FASTA
>7RF6_3 Photosystem II CP43 reaction center protein (chains C, c)
MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEL
AHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYH
AIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPG
GGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHI
LTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQA
QAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFV
LAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Sequence of entity 4 (D, d), FASTA
>7RF6_4 Photosystem II D2 protein (chains D, d)
MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAF
GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFR
FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFIS
QEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Sequence of entity 5 (E, e), FASTA
>7RF6_5 Cytochrome b559 subunit alpha (chains E, e)
MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQ
RSIPLVTDRFEAKQQVETFLEQLK
Sequence of entity 6 (F, f), FASTA
>7RF6_6 Cytochrome b559 subunit beta (chains F, f)
MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Sequence of entity 7 (H, h), FASTA
>7RF6_7 Photosystem II reaction center protein H (chains H, h)
MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNV
SWKALG
Sequence of entity 8 (I, i), FASTA
>7RF6_8 Photosystem II reaction center protein I (chains I, i)
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE
Sequence of entity 9 (J, j), FASTA
>7RF6_9 Photosystem II reaction center protein J (chains J, j)
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Sequence of entity 10 (K, k), FASTA
>7RF6_10 Photosystem II reaction center protein K (chains K, k)
MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Sequence of entity 11 (L, l), FASTA
>7RF6_11 Photosystem II reaction center protein L (chains L, l)
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Sequence of entity 12 (M, m), FASTA
>7RF6_12 Photosystem II reaction center protein M (chains M, m)
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| OEY | Ca-MN4-O6 cluster | Ca Mn4 O6 | 2 |
| PHO | Pheophytin a | C55 H74 N4 O5 | 4 |
| PL9 | 2,3-dimethyl-5-(3,7,11,15,19,23,27,31,35-nonamethyl-2,6,10,14,18,22,26,30,34-he… | C53 H80 O2 | 4 |
| LMG | 1,2-distearoyl-monogalactosyl-diglyceride | C45 H86 O10 | 13 |
| DGD | Digalactosyl diacyl glycerol (DGDG) | C51 H96 O15 | 9 |
| BCT | Bicarbonate ion | C H O3 | 2 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 2 |
| HEC | Heme C | C34 H36 Fe N4 O4 | 2 |
| STE | Stearic acid | C18 H36 O2 | 35 |
| SQD | 1,2-di-O-acyl-3-O-[6-deoxy-6-sulfo-alpha-D-glucopyranosyl]-sn-glycerol | C41 H78 O12 S | 8 |
| LHG | 1,2-dipalmitoyl-phosphatidyl-glycerole | C38 H75 O10 P | 10 |
| BCR | Beta-carotene | C40 H56 | 22 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 70 |
| FE2 | FE (II) ion | Fe | 2 |
| OEX | Ca-MN4-O5 cluster | Ca Mn4 O5 | 2 |
Water and common crystallization additives (CL) are not listed.
Primary citation
Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition. Hussein, R., Ibrahim, M., Bhowmick, A. et al. Nat Commun (2021) 12:6531-6531. DOI 10.1038/s41467-021-26781-z · PubMed
Other PDB entries of the same protein (UniProt P0A444 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5OJ5 1.08 Å, YCF48 bound to D1 peptide
- 9EVX 1.71 Å, cryoEM structure of Photosystem II averaged across S2-S3 states at 1.71 Angstrom…
- 7RF1 1.89 Å, RT XFEL structure of Photosystem II averaged across all S-states at 1.89 Angstrom…
- 9Z35 1.93 Å, RT XFEL structure of two-flash state of Photosystem II (2F, S3 rich) at 1.93 Angstrom…
- 9Z6A 1.93 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3 rich) at 1.93…
- 9Z33 1.97 Å, RT XFEL structure of dark-stable state of Photosystem II (0F, S1 rich) at 1.97 Angstrom…
- 9Z68 1.97 Å, RT XFEL structure of the dark-stable state of Photosystem II (0F, S1 rich) at 1.97…
- 9Z34 1.98 Å, RT XFEL structure of one-flash state of Photosystem II (1F, S2 rich) at 1.98 Angstrom…
- 9Z69 1.98 Å, RT XFEL structure of the one-flash state of Photosystem II (1F, S2 rich) at 1.98…
- 8F4C 2.0 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.00…
- 8F4I 2.0 Å, RT XFEL structure of Photosystem II 2000 microseconds after the third illumination at…
- 8F4J 2.0 Å, RT XFEL structure of Photosystem II 4000 microseconds after the third illumination at…
Browse structure collections
About this viewer
MolViewer shows 7RF6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.