7RMM: Capsid protein P24

Structure of N74D mutant of disulfide stabilized HIV-1 CA hexamer. Determined by X-ray diffraction at 1.97 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Human immunodeficiency virus 1
Chains: 3
Atoms: 5,243
Mol. weight: 77.75 kDa
Released: 3 Aug 2022

Explore 7RMM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RMM contains 43 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-12	3	1
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	96-100	5
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-145	20
α-helix	150-152	3
α-helix	161-174	14
α-helix	179-185	7
α-helix	186-190	5
α-helix	196-205	10
α-helix	211-217	7

Chain B: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
β-strand	10-12	3	2
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-58	10
α-helix	63-83	21
α-helix	95-100	6
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-145	20
α-helix	150-152	3
α-helix	161-175	15
α-helix	179-184	6
α-helix	189-192	4
α-helix	196-205	10
α-helix	211-217	7

Chain C: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	3
β-strand	11-12	2	3
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	96-100	5
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-145	20
α-helix	150-152	3
α-helix	161-175	15
α-helix	196-205	10
α-helix	211-217	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein P24	A, B, C	protein	231	Human immunodeficiency virus 1	B6DRA0

Sequence of entity 1 (A, B, C), FASTA

>7RMM_1 CAPSID PROTEIN P24 (chains A, B, C)
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVG
GHQAAMQMLKETIDEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTH
NPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQE
VKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Primary citation

Structural and Mechanistic Bases of Viral Resistance to HIV-1 Capsid Inhibitor Lenacapavir. Bester, S.M., Adu-Ampratwum, D., Annamalai, A.S. et al. mBio (2022) 13:e0180422-e0180422. DOI 10.1128/mbio.01804-22 · PubMed

Other PDB entries of the same protein (UniProt B6DRA0), best resolution first:

6R8C 1.92 Å, HIV capsid hexamer with IP5 ligand
9RPC 1.97 Å, HIV-1 capsid (M-group) - native
6ERM 2.0 Å, HIV Hexamer with ligand
9S6W 2.07 Å, HIV-1 capsid (M-group) - native in complex with JW3-100
9S6O 2.09 Å, HIV-1 capsid (M-group) - native in complex with JW3-076
9PGT 2.2 Å, HIV Capsid Hexamer bound to Compound 12
7RMJ 2.27 Å, Disulfide stabilized HIV-1 CA hexamer in complex with capsid inhibitor…
9PGV 2.3 Å, HIV Capsid Hexamer bound to Compound 24
6ERN 2.36 Å, HIV Hexamer with ligand
9S6V 2.36 Å, HIV-1 capsid (M-group) - native in complex with JW3-094
9PGS 2.4 Å, HIV Capsid Hexamer bound to Compound 6
9S6J 2.4 Å, HIV-1 capsid (M-group) - CPSF6

Browse structure collections

About this viewer

MolViewer shows 7RMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.