7RUQ: Human GIGYF1-TNRC6C complex

Structure of the human GIGYF1-TNRC6C complex. Determined by X-ray diffraction at 1.79 Å resolution. Released 24 Aug 2022.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,210
Mol. weight: 19.6 kDa
Released: 24 Aug 2022

Explore 7RUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RUQ contains 6 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	475-480	6	1
β-strand	486-491	6	1
α-helix	492-501	10
β-strand	509-512	4	1
β-strand	519-520	2	1
α-helix	521-528	8

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1474-1475	2

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	475-480	6	2
β-strand	486-491	6	2
α-helix	492-500	9
β-strand	509-512	4	2
β-strand	519-520	2	2
α-helix	521-528	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GRB10-interacting GYF protein 1	A, C	protein	73	Homo sapiens	O75420 (AlphaFold model)
Trinucleotide repeat-containing gene 6C protein	B, D	protein	16	Homo sapiens	Q9HCJ0 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7RUQ_1 GRB10-interacting GYF protein 1 (chains A, C)
GPLESHGAARKWFYKDPQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVI
KMWGRVPFAPGPS

Sequence of entity 2 (B, D), FASTA

>7RUQ_2 Trinucleotide repeat-containing gene 6C protein (chains B, D)
GPLGSAPTRPPPGLTN

Primary citation

Molecular basis for GIGYF-TNRC6 complex assembly. Sobti, M., Mead, B.J., Stewart, A.G. et al. RNA (2023) 29:724-734. DOI 10.1261/rna.079596.123 · PubMed

Other PDB entries of the same protein (UniProt O75420 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NVK 2.9 Å, Crystal structure of the human 4EHP-GIGYF1 complex

Browse structure collections

About this viewer

MolViewer shows 7RUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.