7RV1: BCL6 BTB domain

Crystal structure of the BCL6 BTB domain in complex with OICR-8826. Determined by X-ray diffraction at 1.17 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 1.17 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,179
Mol. weight: 15.32 kDa
Ligands: 7RH
Released: 9 Nov 2022

Explore 7RV1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RV1 contains 7 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-27	14
β-strand	34-38	5	1
β-strand	41-45	5	1
α-helix	47-53	7
α-helix	55-62	8
β-strand	71-73	3	1
α-helix	74-75	2
α-helix	80-92	13
α-helix	102-112	11
α-helix	115-126	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A	protein	127	Homo sapiens	P41182 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RV1_1 B-cell lymphoma 6 protein (chains A)
GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFT
DQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCR
KFIKASE

Ligands and cofactors

ID	Name	Formula	Copies
7RH	(E)-3-(7-(2-((3-chloropyridin-4-yl)amino)-2-oxoethyl)-3-(3-(1-methyl-1H-pyrazol…	C23 H19 Cl N8 O3	1

Water and common crystallization additives (SO4, DMS) are not listed.

Primary citation

Crystal structure of the BCL6 BTB domain in complex with OICR-8826. Watson, I., Isaac, M. To be published.

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
1R29 1.3 Å, Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311
7OKG 1.32 Å, Crystal structure of human BCL6 BTB domain in complex with compound 8e

Browse structure collections

About this viewer

MolViewer shows 7RV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.