Crystal structure of the BCL6 BTB domain in complex with OICR-9124. Determined by X-ray diffraction at 1.35 Å resolution. Released 24 Aug 2022.
Explore 7RV3 in 3D Show helices and sheets RCSB PDB PDBe
7RV3 contains 7 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-10 | 3 | |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 1 |
| β-strand | 41-45 | 5 | 1 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-62 | 8 | |
| β-strand | 71-73 | 3 | 1 |
| α-helix | 80-92 | 13 | |
| α-helix | 102-111 | 10 | |
| α-helix | 115-126 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Isoform 2 of B-cell lymphoma 6 protein | A | protein | 127 | Homo sapiens | P41182 (AlphaFold model) |
>7RV3_1 Isoform 2 of B-cell lymphoma 6 protein (chains A) GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFT DQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCR KFIKASE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7R5 | N-(3-chloropyridin-4-yl)-2-[2-(morpholin-4-yl)-4-oxo-3,4-dihydro-7H-pyrrolo[2,3… | C17 H17 Cl N6 O3 | 1 |
Water and common crystallization additives (CL, SO4) are not listed.
Structure of the BCL6 BTB domain. Watson, I., Isaac, M. To be published.
Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7RV3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.