Crystal structure of junctophilin-2. Determined by X-ray diffraction at 2.35 Å resolution. Released 23 Feb 2022.
Explore 7RXE in 3D Show helices and sheets RCSB PDB PDBe
7RXE contains 5 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 13-19 | 7 | 1 |
| β-strand | 22-30 | 9 | 1 |
| α-helix | 32-34 | 3 | |
| β-strand | 37-43 | 7 | 1 |
| β-strand | 46-53 | 8 | 1 |
| β-strand | 59-65 | 7 | 1 |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 90-99 | 10 | 1 |
| β-strand | 105-111 | 7 | 1 |
| β-strand | 114-122 | 9 | 1 |
| β-strand | 128-134 | 7 | 1 |
| β-strand | 137-146 | 10 | 1 |
| α-helix | 159-275 | 4 | |
| β-strand | 289-296 | 8 | 1 |
| β-strand | 299-308 | 10 | 1 |
| β-strand | 313-319 | 7 | 1 |
| β-strand | 322-330 | 9 | 1 |
| β-strand | 336-342 | 7 | 1 |
| β-strand | 345-348 | 4 | 1 |
| α-helix | 358-360 | 3 | |
| α-helix | 362-422 | 61 | |
| α-helix | 429-435 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Junctophilin-2 N-terminal fragment | A | protein | 327 | Homo sapiens | Q9BR39 (AlphaFold model) |
>7RXE_1 Junctophilin-2 N-terminal fragment (chains A) SNAMSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSG NTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDG YGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTEAAPFEADIDATTTET YMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDT KRRMLQLKSNKVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQ ESNIARTLARELAPDFYQPGPEYQKRR
Structures of the junctophilin/voltage-gated calcium channel interface reveal hot spot for cardiomyopathy mutations. Yang, Z.F., Panwar, P., McFarlane, C.R. et al. Proc Natl Acad Sci U S A (2022) 119:e2120416119-e2120416119. DOI 10.1073/pnas.2120416119 · PubMed
Other PDB entries of the same protein (UniProt Q9BR39 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7RXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.