7RYL: T cell receptor CO3

T cell receptor CO3. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 May 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,746
Mol. weight: 51.86 kDa
Released: 18 May 2022

Explore 7RYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RYL contains 16 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	21-23	3	2
α-helix	28-29	2
β-strand	35-40	6	1
β-strand	47-53	7	1
β-strand	58-61	4	1
α-helix	62	1
β-strand	70-71	2	2
β-strand	82-84	3	2
α-helix	89-91	3
β-strand	93-100	8	1
β-strand	107-109	3	1
α-helix	111-112	2
β-strand	113-118	6	1
α-helix	121-123	3
β-strand	125	1	3
α-helix	126-127	2
β-strand	128-132	5	4
α-helix	133-135	3
α-helix	136-142	7
β-strand	144-154	11	4
β-strand	155	1	3
β-strand	159-165	7	5
β-strand	168-169	2	5
β-strand	174-176	3	4
α-helix	180	1
β-strand	181-182	2	4
β-strand	192-201	10	4
α-helix	202-205	4
β-strand	211-218	8	5
β-strand	221	1	6
β-strand	235	1	6
β-strand	237-244	8	5

Chain D: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	7
β-strand	11-15	5	8
β-strand	20-22	3	7
β-strand	25-27	3	7
β-strand	33-41	9	8
β-strand	45-53	9	8
α-helix	57-59	3
β-strand	60-61	2	7
β-strand	64-69	6	7
α-helix	70-72	3
β-strand	74-79	6	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	104-105	2	8
β-strand	109-114	6	8
β-strand	123-128	6	9
β-strand	129	1	4
β-strand	136-141	6	9
α-helix	150-152	3
β-strand	157-159	3	9
α-helix	160-162	3
β-strand	163-167	5	9
β-strand	172-181	10	9
α-helix	188-191	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T cell receptor gamma variable 4,T cell receptor beta constant 1	C	protein	248	Homo sapiens	A0A0C4DH28 (AlphaFold model), P01850 (AlphaFold model)
T cell receptor delta variable 1,T cell receptor alpha chain constant	D	protein	209	Homo sapiens	A0A1B0GX56 (AlphaFold model), P01848 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>7RYL_1 T cell receptor gamma variable 4,T cell receptor beta constant 1 (chains C)
MASSNLEGRTKSVIRQTGSSAEITCDLAEGSTGYIHWYLHQEGKAPQRLLYYDSYTSSVV
LESGISPGKYDTYGSTRKNLRMILRNLIENDSGVYYCATWDGDYYKKLFGSGTTLVVTED
LKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQP
LKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVS
AEAWGRAD

Sequence of entity 2 (D), FASTA

>7RYL_2 T cell receptor delta variable 1,T cell receptor alpha chain constant (chains D)
MAQKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAK
SGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGELRWPDKLIFGKGTRVTVEPNIQNP
DPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAW
SNKSDFACANAFNNSIIPEDTFFPSPESS

Primary citation

Atypical sideways recognition of CD1a by autoreactive gamma delta T cell receptors. Wegrecki, M., Ocampo, T.A., Gunasinghe, S.D. et al. Nat Commun (2022) 13:3872-3872. DOI 10.1038/s41467-022-31443-9 · PubMed

Other PDB entries of the same protein (UniProt A0A0C4DH28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RYN 2.7 Å, CD1a-sulfatide-gdTCR complex
7RYO 3.0 Å, CD1a-dideoxymycobactin-gdTCR complex
7RYM 3.2 Å, CD1a-endo-gdTCR complex

Browse structure collections

About this viewer

MolViewer shows 7RYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.