7S21: EncA

M. xanthus encapsulin shell protein EncA with T=1 symmetry. Determined by electron microscopy at 3.4 Å resolution. Released 2 Feb 2022.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Myxococcus xanthus
Chains: 1
Atoms: 2,041
Mol. weight: 33.51 kDa
Released: 2 Feb 2022

Explore 7S21 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S21 contains 10 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	13-30	18
α-helix	33-35	3
α-helix	38-39	2
β-strand	40	1	1
α-helix	41	1
β-strand	49-51	3	2
β-strand	81-83	3	2
α-helix	84-85	2
β-strand	87-93	7	1
α-helix	95-103	9
α-helix	111-129	19
α-helix	161-173	13
β-strand	180-184	5	3
α-helix	186-194	9
α-helix	205-211	7
β-strand	215-217	3	3
β-strand	228-230	3	3
β-strand	237-248	12	1
β-strand	256-267	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EncA	A	protein	301	Myxococcus xanthus	Q1D6H4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7S21_1 EncA (chains A)
MHHHHHHMPLEPHFMPDFLGHAENPLREEEWARLNETVIQVARRSLVGRRILDIYGPLGA
GVQTVPYDEFQGVSPGAVDIVGEQETAMVFTDARKFKTIPIIYKDFLLHWRDIEAARTHN
MPLDVSAAAGAAALCAQQEDELIFYGDARLGYEGLMTANGRLTVPLGDWTSPGGGFQAIV
EATRKLNEQGHFGPYAVVLSPRLYSQLHRIYEKTGVLEIETIRQLASDGVYQSNRLRGES
GVVVSTGRENMDLAVSMDMVAAYLGASRMNHPFRVLEALLLRIKHPDAICTLEGAGATER
R

Primary citation

Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism. Eren, E., Wang, B., Winkler, D.C. et al. Structure (2022) 30:551-563.e4. DOI 10.1016/j.str.2022.01.008 · PubMed

Other PDB entries of the same protein (UniProt Q1D6H4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJO 2.4 Å, Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo
8V4N 2.43 Å, Myxococcus xanthus EncA 3xHis pore mutant with T=1 icosahedral symmetry
8TK7 2.53 Å, Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein
8V4Q 2.71 Å, Myxococcus xanthus EncA 3xHis pore mutant with tetrahedral symmetry
9B9I 2.86 Å, Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry
7S4Q 3.12 Å, M. xanthus encapsulin EncA bound to EncC targeting peptide
9B9Q 3.14 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3…
7S20 3.4 Å, M. xanthus encapsulin shell protein EncA with T=3 symmetry
7S2T 3.45 Å, M. xanthus encapsulin EncA bound to EncB targeting peptide
9BC8 3.46 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4…
4PT2 4.6 Å, Myxococcus xanthus encapsulin protein (EncA)

Browse structure collections

About this viewer

MolViewer shows 7S21 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.