7S24: Na+/H+ antiporter NhaA at pH 6.5

Crystal structure of the Na+/H+ antiporter NhaA at pH 6.5. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Aug 2022.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,923
Mol. weight: 43.26 kDa
Ligands: OLC
Released: 10 Aug 2022

Explore 7S24 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S24 contains 24 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	11-28	18
α-helix	35-42	8
β-strand	45-47	3	1
β-strand	50	1	2
β-strand	52	1	2
β-strand	56-58	3	1
α-helix	59-84	26
α-helix	91-116	26
α-helix	122-125	4
α-helix	128-130	3
α-helix	134-142	9
α-helix	145-147	3
α-helix	150-174	25
α-helix	176-178	3
α-helix	181-200	20
α-helix	205-218	14
α-helix	223-236	14
β-strand	242	1	3
β-strand	245	1	3
α-helix	247-258	12
α-helix	259-263	5
α-helix	264-271	8
α-helix	281-284	4
α-helix	287-294	8
α-helix	295-299	5
α-helix	300-313	14
α-helix	319-320	2
α-helix	325-334	10
α-helix	339-350	12
α-helix	355-383	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) antiporter NhaA	A	protein	396	Escherichia coli	P13738 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7S24_1 Na(+)/H(+) antiporter NhaA (chains A)
MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNML
LWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPTLLYLAFNYADP
ITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLS
MASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK
EKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLGGVTLDGLTSILPLGIIAGMLIGK
PLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINW
AKLGILVGSISSAVIGYSWLRVRLRPSVGSENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	2

Water and common crystallization additives (1PE) are not listed.

Primary citation

Crystal structure of the Na + /H + antiporter NhaA at active pH reveals the mechanistic basis for pH sensing. Winkelmann, I., Uzdavinys, P., Kenney, I.M. et al. Nat Commun (2022) 13:6383-6383. DOI 10.1038/s41467-022-34120-z · PubMed

Other PDB entries of the same protein (UniProt P13738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RH1 2.7 Å, Cryo-EM structure of the consensus inward-facing apo NhaA dimer at pH 7.5
9RH2 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 7.5
9RH3 2.7 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 7.5
9RHB 2.9 Å, Cryo-EM structure of the inward-facing apo NhaA in the open-funnel state at pH 8.5
9RHF 3.0 Å, Cryo-EM structure of the inward-facing sodium-bound NhaA at pH 8.5
9RH4 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA with flexible N-terminus at pH 7.5
9RH8 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 5.5
9RH9 3.1 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 5.5
9RHC 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 8.5
9RHD 3.2 Å, Cryo-EM structure of the inward-facing apo NhaA in the plugged state at pH 8.5
9RH5 3.3 Å, Cryo-EM structure of the inward-facing apo NhaA in the unplugged state at pH 6.3
8PS0 3.37 Å, Cryo-EM structure of Sodium proton exchanger NhaA with bound cardiolipin

Browse structure collections

About this viewer

MolViewer shows 7S24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.