7S4N: Evasin P974

Crystal structure of the tick evasin EVA-P974 complexed to human chemokine CCL17. Determined by X-ray diffraction at 1.65 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.65 Å
Organisms: Amblyomma cajennense, Homo sapiens
Chains: 4
Atoms: 2,414
Mol. weight: 35.6 kDa
Released: 16 Mar 2022

Explore 7S4N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S4N contains 14 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	13-15	3	2
β-strand	21-24	4	2
β-strand	27-30	4	3
β-strand	33-36	4	3
α-helix	37-38	2
β-strand	42-44	3	2
α-helix	48-51	4
α-helix	54-55	2
β-strand	59-68	10	2
β-strand	71-82	12	2

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	8
α-helix	30-31	2
β-strand	39-43	5	8
β-strand	48-51	4	8
α-helix	56-68	13

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	4
β-strand	13-15	3	5
β-strand	22-24	3	5
β-strand	27-30	4	6
β-strand	33-36	4	6
α-helix	37-38	2
β-strand	42-44	3	5
α-helix	48-53	6
α-helix	55	1
β-strand	59-68	10	5
β-strand	71-82	12	5

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	4
α-helix	21-23	3
β-strand	24-29	6	7
α-helix	30-31	2
β-strand	39-43	5	7
β-strand	48-51	4	7
α-helix	56-67	12
α-helix	69-70	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Evasin P974	A, C	protein	85	Amblyomma cajennense	A0A023FDY8 (AlphaFold model)
C-C motif chemokine 17	B, D	protein	71	Homo sapiens	Q92583 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7S4N_1 Evasin P974 (chains A, C)
DYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWY
ECPLGECKNGVCEDLRKKEDCRKGN

Sequence of entity 2 (B, D), FASTA

>7S4N_2 C-C motif chemokine 17 (chains B, D)
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKN
AVKYLQSLERS

Primary citation

Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed

Other PDB entries of the same protein (UniProt A0A023FDY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SO0 1.74 Å, Crystal Structure of the Engineered Tick Evasin EVA-P974(F31A) Complexed to Human…
7S58 1.82 Å, Crystal Structure of the tick evasin EVA-P974 complexed to human chemokine CCL7
7S59 2.39 Å, Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human…

Browse structure collections

About this viewer

MolViewer shows 7S4N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.