Crystal structure of human chemokine CCL8. Determined by X-ray diffraction at 1.37 Å resolution. Released 29 Sept 2021.
Explore 7S5A in 3D Show helices and sheets RCSB PDB PDBe
7S5A contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 22-24 | 3 | |
| β-strand | 25-31 | 7 | 2 |
| β-strand | 40-45 | 6 | 2 |
| β-strand | 50-53 | 4 | 2 |
| α-helix | 58-67 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-11 | 3 | 1 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-31 | 7 | 3 |
| β-strand | 40-45 | 6 | 3 |
| β-strand | 50-53 | 4 | 3 |
| α-helix | 58-71 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-C motif chemokine 8 | A, B | protein | 76 | Homo sapiens | P80075 (AlphaFold model) |
>7S5A_1 C-C motif chemokine 8 (chains A, B) QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWV RDSMKHLDQIFQNLKP
Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed
Other PDB entries of the same protein (UniProt P80075 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7S5A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.