7S5A: Human chemokine CCL8

Crystal structure of human chemokine CCL8. Determined by X-ray diffraction at 1.37 Å resolution. Released 29 Sept 2021.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,422
Mol. weight: 17.86 kDa
Released: 29 Sept 2021

Explore 7S5A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S5A contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	9-11	3	1
α-helix	22-24	3
β-strand	25-31	7	2
β-strand	40-45	6	2
β-strand	50-53	4	2
α-helix	58-67	10

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	1
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-31	7	3
β-strand	40-45	6	3
β-strand	50-53	4	3
α-helix	58-71	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 8	A, B	protein	76	Homo sapiens	P80075 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7S5A_1 C-C motif chemokine 8 (chains A, B)
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWV
RDSMKHLDQIFQNLKP

Primary citation

Structure-guided engineering of tick evasins for targeting chemokines in inflammatory diseases. Bhusal, R.P., Aryal, P., Devkota, S.R. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2122105119 · PubMed

Other PDB entries of the same protein (UniProt P80075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ESR 2.0 Å, Crystal structure of human monocyte chemotactic protein-2
7S59 2.39 Å, Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human…

Browse structure collections

About this viewer

MolViewer shows 7S5A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.