7S5K: M. xanthus ferritin-like protein EncB

M. xanthus ferritin-like protein EncB. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Feb 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Myxococcus xanthus
Chains: 10
Atoms: 5,376
Mol. weight: 79.63 kDa
Ligands: FE, CA
Released: 2 Feb 2022

Explore 7S5K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S5K contains 24 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D, F, G, H and J: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-41	25
α-helix	45-72	28

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-41	25
α-helix	45-72	28
α-helix	74-79	6

Chains C and I: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-41	25
α-helix	45-72	28
α-helix	74-78	5

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-41	25
α-helix	45-72	28
α-helix	74-77	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EncB	A, B, C, D, E, F, G, H, I, J	protein	68	Myxococcus xanthus	Q1D6H3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>7S5K_1 EncB (chains A, B, C, D, E, F, G, H, I, J)
DLDDVARIRLVLARELETINEYEAYARASSNPEVRAFFQHLAAEEKEHVSEAVHMLRMLD
SGQNDHFA

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	16
CA	Calcium ion	Ca	9

Primary citation

Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism. Eren, E., Wang, B., Winkler, D.C. et al. Structure (2022) 30:551-563.e4. DOI 10.1016/j.str.2022.01.008 · PubMed

Other PDB entries of the same protein (UniProt Q1D6H3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S5C 1.86 Å, M. xanthus ferritin-like protein EncB
7S2T 3.45 Å, M. xanthus encapsulin EncA bound to EncB targeting peptide

Browse structure collections

About this viewer

MolViewer shows 7S5K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.