7S8T: M. xanthus ferritin-like protein EncC
M. xanthus ferritin-like protein EncC. Determined by X-ray diffraction at 2.49 Å resolution. Released 2 Feb 2022.
- Method
- X-ray diffraction
- Resolution
- 2.49 Å
- Organism
- Myxococcus xanthus
- Chains
- 10
- Atoms
- 6,434
- Mol. weight
- 154.09 kDa
- Ligands
- FE
- Released
- 2 Feb 2022
Explore 7S8T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7S8T contains 34 α-helices and 2 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-49 | 25 | |
| α-helix | 55-80 | 26 | |
| α-helix | 92-97 | 6 | |
Chains B and I: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-49 | 22 | |
| α-helix | 56-80 | 25 | |
| α-helix | 88-97 | 10 | |
Chain C: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-49 | 23 | |
| α-helix | 55-80 | 26 | |
| β-strand | 81 | 1 | 1 |
| β-strand | 85 | 1 | 1 |
| α-helix | 93-96 | 4 | |
Chain D: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-49 | 22 | |
| α-helix | 55-80 | 26 | |
| α-helix | 92-97 | 6 | |
Chain E: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-49 | 22 | |
| α-helix | 55-82 | 28 | |
| α-helix | 92-96 | 5 | |
| α-helix | 97-99 | 3 | |
Chain F: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 24-28 | 5 | |
| α-helix | 29-49 | 21 | |
| α-helix | 55-82 | 28 | |
| α-helix | 93-97 | 5 | |
Chain G: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-49 | 22 | |
| α-helix | 55-80 | 26 | |
| α-helix | 86-89 | 4 | |
| α-helix | 92-97 | 6 | |
Chain H: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-49 | 22 | |
| α-helix | 56-80 | 25 | |
| α-helix | 86-89 | 4 | |
| α-helix | 92-97 | 6 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| EncC | A, B, C, D, E, F, G, H, I, J | protein | 137 | Myxococcus xanthus | Q1D3Y8 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA
>7S8T_1 EncC (chains A, B, C, D, E, F, G, H, I, J)
MHHHHHHMPQTNPFHSLVPRKMTDTELARSIRLNIEAELDAINLYAAHIDATDNEDAKAI
LQHVMDEEREHAALFWELIARLDPEQAAHAKEAVEKYRLITSGASHEAVEAVGKEGAAPS
PADVTPEKRLTVGSLRR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| FE | FE (III) ion | Fe | 7 |
Primary citation
Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism. Eren, E., Wang, B., Winkler, D.C. et al. Structure (2022) 30:551-563.e4. DOI 10.1016/j.str.2022.01.008 · PubMed
Other PDB entries of the same protein (UniProt Q1D3Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7S4Q 3.12 Å, M. xanthus encapsulin EncA bound to EncC targeting peptide
- 9B9Q 3.14 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3…
- 9BC8 3.46 Å, Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4…
Browse structure collections
About this viewer
MolViewer shows 7S8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.