7SJ7: Tubulin alpha-1B chain

Undecorated 13pf wildtype microtubule from recombinant human tubulin. Determined by electron microscopy at 3.8 Å resolution. Released 19 Jan 2022.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 12
Atoms: 41,056
Mol. weight: 619.8 kDa
Ligands: GDP, MG, GTP
Released: 19 Jan 2022

Explore 7SJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SJ7 contains 301 α-helices and 210 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, E, J, K and L: 25 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	10-27	18
α-helix	49-51	3
β-strand	53-55	3	2
β-strand	61-63	3	2
β-strand	65-69	5	1
α-helix	72-80	9
β-strand	93-94	2	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-113	3
α-helix	115-127	13
β-strand	134-138	5	1
α-helix	144	1
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-169	5	1
β-strand	171	1	3
α-helix	172-174	3
α-helix	183-194	12
β-strand	200	1	1
β-strand	203	1	4
β-strand	204	1	3
α-helix	206-215	10
α-helix	224-243	20
β-strand	248	1	4
α-helix	252-259	8
α-helix	268	1
β-strand	269-273	5	4
α-helix	288-296	9
α-helix	307-309	3
β-strand	312-321	10	4
α-helix	325-337	13
β-strand	352-356	5	4
α-helix	359-360	2
α-helix	362-363	2
β-strand	373-381	9	4
α-helix	384-400	17
α-helix	405-410	6
α-helix	415-436	22
α-helix	438-440	3

Chains B, D, G and I: 25 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	50
α-helix	10-28	19
β-strand	30	1	51
β-strand	36	1	51
α-helix	42-45	4
α-helix	47-49	3
β-strand	51-54	4	52
β-strand	58-61	4	52
β-strand	63-65	3	50
β-strand	66-67	2	53
α-helix	70-78	9
α-helix	87-89	3
β-strand	91-92	2	53
α-helix	101-102	2
α-helix	103-107	5
α-helix	109-126	18
β-strand	130-138	9	50
α-helix	142	1
α-helix	143-147	5
α-helix	148-158	11
β-strand	163-170	8	50
α-helix	171-172	2
α-helix	181-195	15
β-strand	198-200	3	50
β-strand	202-203	2	50
α-helix	204-209	6
α-helix	210-214	5
α-helix	222-241	20
β-strand	246	1	54
α-helix	250-257	8
β-strand	265-266	2	50
β-strand	267-271	5	54
α-helix	286-293	8
α-helix	296-298	3
α-helix	305-307	3
β-strand	310-317	8	54
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	54
β-strand	349-353	5	54
β-strand	365-371	7	54
α-helix	375-390	16
α-helix	395-399	5
α-helix	405-426	22

Chain F: 26 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	25
α-helix	10-28	19
β-strand	30	1	26
β-strand	36	1	26
α-helix	42-45	4
α-helix	47-49	3
β-strand	51-54	4	27
β-strand	58-61	4	27
β-strand	63-65	3	25
β-strand	66-67	2	28
α-helix	70-78	9
α-helix	87-89	3
β-strand	91-92	2	28
α-helix	101-102	2
α-helix	103-107	5
α-helix	109-126	18
β-strand	130-138	9	25
α-helix	142	1
α-helix	143-147	5
α-helix	148-158	11
β-strand	163-170	8	25
α-helix	171-172	2
α-helix	181-195	15
β-strand	198-200	3	25
β-strand	202-203	2	25
α-helix	204-209	6
α-helix	210-214	5
α-helix	222-241	20
β-strand	246	1	29
α-helix	250-257	8
β-strand	265-266	2	25
β-strand	267-271	5	29
α-helix	286-293	8
α-helix	296-298	3
α-helix	305-307	3
β-strand	310-317	8	29
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	29
β-strand	349-353	5	29
α-helix	357-358	2
β-strand	365-371	7	29
α-helix	375-390	16
α-helix	395-399	5
α-helix	405-426	22

Chain H: 25 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	40
α-helix	10-28	19
β-strand	30	1	41
β-strand	36	1	41
α-helix	41-45	5
α-helix	47-49	3
β-strand	51-54	4	42
β-strand	58-61	4	42
β-strand	63-65	3	40
β-strand	66-67	2	43
α-helix	70-78	9
α-helix	87-89	3
β-strand	91-92	2	43
α-helix	101-102	2
α-helix	103-107	5
α-helix	109-126	18
β-strand	130-138	9	40
α-helix	142	1
α-helix	143-147	5
α-helix	148-158	11
β-strand	163-170	8	40
α-helix	171-172	2
α-helix	181-195	15
β-strand	198-200	3	40
β-strand	202-203	2	40
α-helix	204-209	6
α-helix	210-214	5
α-helix	222-241	20
β-strand	246	1	44
α-helix	250-257	8
β-strand	265-266	2	40
β-strand	267-271	5	44
α-helix	286-293	8
α-helix	296-298	3
α-helix	305-307	3
β-strand	310-317	8	44
α-helix	323-336	14
α-helix	338-340	3
β-strand	341	1	44
β-strand	349-353	5	44
β-strand	365-371	7	44
α-helix	375-390	16
α-helix	395-399	5
α-helix	405-426	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1B chain	A, C, E, J, K, L	protein	457	Homo sapiens	P68363 (AlphaFold model)
Tubulin beta-3 chain	B, D, F, G, H, I	protein	456	Homo sapiens	Q13509 (AlphaFold model)

Sequence of entity 1 (A, C, E, J, K, L), FASTA

>7SJ7_1 Tubulin alpha-1B chain (chains A, C, E, J, K, L)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFS
ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEI
IDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPA
PQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQI
VSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNA
CFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVG
INYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME
EGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 2 (B, D, F, G, H, I), FASTA

>7SJ7_2 Tubulin beta-3 chain (chains B, D, F, G, H, I)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDEEESEAQGPKENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	6
MG	Magnesium ion	Mg	6
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	6

Primary citation

Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules. LaFrance, B.J., Roostalu, J., Henkin, G. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2114994119 · PubMed

Other PDB entries of the same protein (UniProt P68363 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8L 1.8 Å, Structure, Thermodynamics, and Kinetics of Plinabulin Binding to two Tubulin Isotypes
6J8O 1.85 Å, Structure of a hypothetical protease
7PJF 1.86 Å, Inhibiting parasite proliferation using a rationally designed anti-tubulin agent
6J4V 2.1 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
8VT7 2.66 Å, Structure of the gamma tubulin ring complex nucleated microtubule protofilament.
7Z6S 2.9 Å, MATCAP bound to a human 14 protofilament microtubule
8V2J 2.9 Å, Structure of alpha1B and betaI/IVb microtubule bound to GDP
9COC 2.9 Å, Two protofilament structure of alpha1B and betaI/IVb microtubule bound to GDP
9BP6 3.1 Å, Structure of alpha1B and betaI/IVb microtubule bound to GMPCPP
9CMM 3.1 Å, Two protofilament structure of alpha1B and betaI/IVb microtubule bound to GMPCPP
7LXB 3.26 Å, HeLa-tubulin in complex with cryptophycin 52
9HQ4 3.28 Å, TTLL11 bound to microtubule

Browse structure collections

About this viewer

MolViewer shows 7SJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.