7SZK: 27a

Cryo-EM structure of 27a bound to E. coli RNAP and rrnBP1 promoter complex. Determined by electron microscopy at 2.94 Å resolution. Released 13 Jul 2022.

Method: Electron microscopy
Resolution: 2.94 Å
Organism: Escherichia coli K-12
Chains: 8
Atoms: 29,759
Mol. weight: 500.65 kDa
Ligands: MG, D9X, ZN
Released: 13 Jul 2022

Explore 7SZK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SZK contains 162 α-helices and 225 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	17	1	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	53-61	9	2
β-strand	74	1	3
α-helix	78-86	9
β-strand	90	1	4
β-strand	97-105	9	2
β-strand	108-111	4	3
α-helix	112-114	3
β-strand	115	1	2
α-helix	116-117	2
β-strand	123	1	4
β-strand	129-133	5	3
β-strand	139-149	11	2
β-strand	152-153	2	5
α-helix	155-160	6
β-strand	171-172	2	2
β-strand	175-176	2	5
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-232	20

Chain B: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	13-17	5	6
β-strand	24-31	8	6
α-helix	35-49	15
β-strand	52-61	10	7
β-strand	74	1	8
α-helix	78-86	9
β-strand	90-91	2	9
β-strand	98-105	8	7
β-strand	108-111	4	8
α-helix	112-114	3
β-strand	115	1	7
α-helix	116-117	2
β-strand	122-123	2	9
β-strand	129-133	5	8
β-strand	139-150	12	7
β-strand	152-153	2	10
α-helix	155-160	6
β-strand	170-172	3	7
β-strand	175-176	2	10
β-strand	183-189	7	6
β-strand	192	1	11
β-strand	195	1	11
β-strand	199-205	7	6
α-helix	213-232	20

Chain C: 58 helices, 101 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
α-helix	11-12	2
β-strand	13-14	2	12
α-helix	19-20	2
α-helix	29-39	11
α-helix	49-56	8
α-helix	57	1
β-strand	59-60	2	13
β-strand	66-75	10	13
α-helix	82-88	7
β-strand	93-104	12	13
β-strand	115-117	3	13
β-strand	122-128	7	13
α-helix	129-130	2
β-strand	136-137	2	14
β-strand	142-145	4	14
β-strand	148-151	4	15
α-helix	152	1
β-strand	154-155	2	16
β-strand	158	1	16
α-helix	164-166	3
β-strand	173-177	5	16
β-strand	180	1	17
α-helix	182-183	2
β-strand	184-187	4	16
β-strand	195-197	3	16
β-strand	205	1	16
α-helix	207-212	6
α-helix	217-224	8
β-strand	229-230	2	18
β-strand	240	1	18
α-helix	244-246	3
β-strand	250	1	19
β-strand	257	1	20
β-strand	260	1	20
β-strand	268	1	19
α-helix	271-280	10
β-strand	284	1	18
α-helix	289-292	4
β-strand	296	1	21
β-strand	297	1	22
β-strand	301	1	23
β-strand	311	1	23
β-strand	316	1	21
α-helix	319-327	9
β-strand	333-334	2	18
β-strand	335	1	22
α-helix	346-353	8
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	17
α-helix	399-408	10
α-helix	422-437	16
β-strand	451-454	4	15
α-helix	456-481	26
α-helix	496-507	12
β-strand	512-514	3	14
α-helix	515-516	2
α-helix	520-527	8
α-helix	540-542	3
α-helix	552-554	3
β-strand	558	1	24
β-strand	575	1	24
β-strand	580-581	2	25
β-strand	587-588	2	25
β-strand	589-594	6	26
β-strand	598	1	27
β-strand	599-606	8	26
α-helix	608-613	6
β-strand	616-617	2	26
β-strand	623	1	28
β-strand	628	1	27
β-strand	629	1	28
β-strand	634-637	4	26
β-strand	642-645	4	26
α-helix	647-649	3
β-strand	652-654	3	26
α-helix	663-666	4
α-helix	671-673	3
β-strand	674	1	29
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	30
β-strand	700-701	2	12
α-helix	705-711	7
β-strand	716-717	2	31
β-strand	722-728	7	32
β-strand	731-736	6	32
β-strand	749-752	4	32
β-strand	757-758	2	33
β-strand	763	1	34
β-strand	764-765	2	33
β-strand	768-769	2	31
β-strand	776-777	2	32
β-strand	782-785	4	31
β-strand	789-790	2	35
β-strand	793-794	2	35
β-strand	798-804	7	36
β-strand	816-819	4	36
α-helix	821-824	4
β-strand	830-841	12	34
β-strand	842	1	37
β-strand	847	1	37
β-strand	849	1	38
α-helix	859-862	4
β-strand	865	1	39
β-strand	870	1	40
β-strand	871	1	39
α-helix	872	1
β-strand	876-877	2	34
β-strand	882-884	3	40
β-strand	887-889	3	38
α-helix	897-906	10
β-strand	913-915	3	38
β-strand	918-919	2	40
α-helix	920-921	2
β-strand	926-935	10	34
β-strand	936	1	41
α-helix	943-980	38
α-helix	986-991	6
α-helix	994-999	6
α-helix	1006-1037	32
β-strand	1040	1	41
β-strand	1046-1058	13	34
α-helix	1059-1060	2
β-strand	1065	1	42
β-strand	1066-1067	2	43
β-strand	1075	1	42
β-strand	1076-1080	5	36
α-helix	1082-1084	3
β-strand	1087	1	44
β-strand	1093	1	44
β-strand	1096-1098	3	36
α-helix	1100-1102	3
β-strand	1108	1	29
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1167-1176	10
β-strand	1182-1183	2	12
α-helix	1192-1201	10
β-strand	1209-1210	2	36
β-strand	1213	1	44
α-helix	1219	1
β-strand	1220	1	44
α-helix	1221	1
β-strand	1225-1232	8	36
β-strand	1233-1234	2	43
β-strand	1235	1	30
α-helix	1239-1241	3
β-strand	1244-1246	3	45
β-strand	1251	1	46
β-strand	1252	1	47
β-strand	1258	1	46
β-strand	1268-1269	2	48
α-helix	1272-1280	9
α-helix	1284-1292	9
α-helix	1298-1310	13
α-helix	1321-1332	12
β-strand	1335-1339	5	49

Chain D: 63 helices, 83 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	49
α-helix	27-33	7
β-strand	37	1	50
β-strand	44	1	51
β-strand	51	1	51
α-helix	52	1
β-strand	84	1	52
β-strand	91	1	52
α-helix	95-99	5
β-strand	103-112	10	50
α-helix	115-118	4
α-helix	123-127	5
α-helix	132-139	8
β-strand	144-146	3	53
β-strand	159-160	2	53
α-helix	162-171	10
β-strand	178-179	2	53
α-helix	182-191	10
α-helix	194-207	14
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	50
α-helix	247-249	3
α-helix	253	1
β-strand	254	1	54
α-helix	255	1
β-strand	260	1	54
β-strand	261-262	2	55
α-helix	264-285	22
α-helix	289-307	19
α-helix	315	1
β-strand	316	1	56
α-helix	317	1
β-strand	323	1	56
α-helix	324	1
α-helix	327-331	5
α-helix	337-340	4
β-strand	346-347	2	48
β-strand	350-356	7	45
β-strand	365-369	5	45
α-helix	370-387	18
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	45
α-helix	431-433	3
β-strand	434-442	9	45
β-strand	446-448	3	45
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	45
α-helix	474-483	10
β-strand	485	1	45
β-strand	491	1	57
β-strand	498	1	57
α-helix	505-513	9
β-strand	526-527	2	58
α-helix	530-539	10
β-strand	547-556	10	58
β-strand	564-573	10	58
α-helix	574-579	6
α-helix	589-591	3
α-helix	598-611	14
α-helix	615-635	21
α-helix	641-643	3
α-helix	645-647	3
α-helix	650-669	20
α-helix	675-703	29
β-strand	706-708	3	59
β-strand	713-715	3	59
α-helix	721-728	8
α-helix	734-741	8
β-strand	748	1	60
β-strand	754	1	60
α-helix	769-803	35
β-strand	808	1	61
β-strand	809-811	3	62
β-strand	820-822	3	63
β-strand	825-827	3	64
β-strand	828	1	65
β-strand	830-833	4	64
α-helix	835-839	5
β-strand	843	1	66
β-strand	844	1	63
α-helix	847	1
β-strand	848-849	2	67
α-helix	850	1
β-strand	856-858	3	67
β-strand	863	1	66
α-helix	866-874	9
β-strand	880-882	3	63
α-helix	885-887	3
β-strand	894-895	2	62
α-helix	896-899	4
β-strand	914	1	61
α-helix	915-924	10
α-helix	925-929	5
β-strand	949-951	3	68
β-strand	956	1	69
β-strand	959-961	3	70
β-strand	965-967	3	71
β-strand	973-975	3	71
β-strand	980-983	4	70
β-strand	985	1	72
β-strand	991	1	72
β-strand	994	1	65
β-strand	995-997	3	70
β-strand	1002-1003	2	68
β-strand	1011	1	69
β-strand	1016-1019	4	68
β-strand	1033	1	73
β-strand	1035-1038	4	74
β-strand	1042	1	75
β-strand	1046	1	75
β-strand	1050	1	76
β-strand	1057	1	76
β-strand	1077-1080	4	74
β-strand	1081	1	77
β-strand	1087	1	77
β-strand	1089	1	78
α-helix	1090	1
β-strand	1096	1	78
β-strand	1098	1	74
α-helix	1110	1
β-strand	1115	1	73
α-helix	1116	1
α-helix	1138-1146	9
α-helix	1153-1155	3
β-strand	1156	1	79
β-strand	1161-1165	5	80
β-strand	1175-1178	4	80
β-strand	1187-1188	2	80
β-strand	1203-1204	2	80
β-strand	1209	1	79
α-helix	1217-1224	8
α-helix	1226-1242	17
α-helix	1250-1260	11
β-strand	1263-1266	4	81
β-strand	1277-1279	3	81
α-helix	1280-1292	13
β-strand	1302-1304	3	81
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	49
α-helix	1347-1353	7
α-helix	1363-1372	10

Chain E: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	19-31	13
α-helix	40-41	2
α-helix	46-55	10
α-helix	61-76	16

Chain F: 23 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	97-107	11
α-helix	113-136	24
α-helix	140-152	13
α-helix	158-161	4
β-strand	162-165	4	82
α-helix	214-233	20
α-helix	244-258	15
β-strand	259-261	3	82
α-helix	263-295	33
α-helix	299-306	8
α-helix	314-321	8
α-helix	325-351	27
α-helix	355-391	37
α-helix	401-417	17
α-helix	427-445	19
α-helix	454-474	21
α-helix	480-486	7
α-helix	493-499	7
α-helix	504	1
β-strand	505-506	2	55
β-strand	510	1	83
β-strand	518	1	83
α-helix	519-522	4
β-strand	524	1	47
α-helix	531-550	20
α-helix	553-562	10
α-helix	573-579	7
α-helix	585-599	15
α-helix	605-610	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	A, B	protein	329	Escherichia coli K-12	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	C	protein	1342	Escherichia coli K-12	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	D	protein	1407	Escherichia coli K-12	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	E	protein	91	Escherichia coli K-12	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	F	protein	613	Escherichia coli K-12	P00579
DNA (5'-d(pcptpcpgptpapgpapgptpcpcpgptpgptpcpa)-3')	X	DNA	64	Escherichia coli K-12
DNA (5'-d(pcptpcpgptpapgpapgptpcpcpgptpgptpcpa)-3')	Y	DNA	64	Escherichia coli K-12

Sequence of entity 1 (A, B), FASTA

>7SZK_1 DNA-directed RNA polymerase subunit alpha (chains A, B)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (C), FASTA

>7SZK_2 DNA-directed RNA polymerase subunit beta (chains C)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (D), FASTA

>7SZK_3 DNA-directed RNA polymerase subunit beta' (chains D)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (E), FASTA

>7SZK_4 DNA-directed RNA polymerase subunit omega (chains E)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (F), FASTA

>7SZK_5 RNA polymerase sigma factor RpoD (chains F)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (X), FASTA

>7SZK_6 DNA (5'-D(P*CP*TP*CP*GP*TP*AP*GP*AP*GP*TP*CP*CP*GP*TP*GP*TP*CP*A)-3') (chains X)
ATTTCCTCTTGTCAGGCCGGAATAACTCCCTATAATGCGCCACCACTGACACGGACTCTA
CGAG

Sequence of entity 7 (Y), FASTA

>7SZK_7 DNA (5'-D(P*CP*TP*CP*GP*TP*AP*GP*AP*GP*TP*CP*CP*GP*TP*GP*TP*CP*A)-3') (chains Y)
CTCGTAGAGTCCGTGTCAGTGGTGGCGCATTATAGGGAGTTATTCCGGCCTGACAAGAGG
AAAT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
D9X	(2S,7R,7aR,13aP,16Z,18E,20S,21S,22R,23R,24R,25S,26R,27S,28E)-5,21,23-trihydroxy…	C63 H81 N5 O14	1
ZN	Zinc ion	Zn	2

Primary citation

Optimization of Benzoxazinorifamycins to Improve Mycobacterium tuberculosis RNA Polymerase Inhibition and Treatment of Tuberculosis. Rajeswaran, W., Ashkar, S.R., Lee, P.H. et al. ACS Infect Dis (2022) 8:1422-1438. DOI 10.1021/acsinfecdis.1c00636 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 7SZK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.