7TJ7: Cardiac actin

Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac myosin binding protein C (cMyBP-C). Determined by electron microscopy at 8.0 Å resolution. Released 23 Nov 2022.

Method: Electron microscopy
Resolution: 8.0 Å
Organisms: Sus scrofa, Homo sapiens
Chains: 22
Atoms: 27,167
Mol. weight: 594.65 kDa
Released: 23 Nov 2022

Explore 7TJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TJ7 contains 154 α-helices and 222 β-strands across 22 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 19 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	16-21	6	1
β-strand	29-32	4	1
α-helix	54-57	4
β-strand	62	1	2
β-strand	65	1	2
β-strand	71	1	3
β-strand	76	1	3
α-helix	80-88	9
α-helix	89-93	5
α-helix	98-100	3
β-strand	103-105	3	1
β-strand	106-107	2	4
α-helix	113-125	13
β-strand	131-132	2	5
β-strand	135-136	2	4
α-helix	137-145	9
β-strand	149	1	6
β-strand	152-154	3	7
β-strand	161-162	2	7
β-strand	166	1	6
β-strand	176-177	2	7
α-helix	182-195	14
α-helix	203-215	13
α-helix	225-232	8
β-strand	238-240	3	8
β-strand	248-250	3	8
α-helix	253-256	4
α-helix	258-262	5
α-helix	274-284	11
α-helix	289-295	7
β-strand	297-300	4	7
α-helix	302-304	3
α-helix	309-320	12
β-strand	329-330	2	7
α-helix	335-348	14
α-helix	353-355	3
β-strand	357-358	2	5
α-helix	359-364	6
α-helix	368-370	3

Chains G, H, I, J, K and L: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	321-326	6
α-helix	333-339	7
α-helix	345-356	12

Chains M, N, O, P, Q and R: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	164	1	49
β-strand	167	1	50
β-strand	174-179	6	51
α-helix	186-187	2
β-strand	188	1	52
α-helix	189	1
β-strand	191	1	53
β-strand	192	1	54
β-strand	198	1	54
α-helix	200-202	3
β-strand	208-213	6	51
β-strand	219-225	7	51
β-strand	235-238	4	49
β-strand	239	1	53
β-strand	241	1	55
β-strand	242	1	52
β-strand	248	1	55
β-strand	251-254	4	49
β-strand	257	1	50

Chain S: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	64-195	132

Chains T, U and V: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	63-195	133

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cardiac actin	A, B, C, D, E, F	protein	375	Sus scrofa	P68137 (AlphaFold model)
Myosin-binding protein C, cardiac-type	G, H, I, J, K, L, M, N, O, P, Q, R	protein	220	Homo sapiens	Q14896 (AlphaFold model)
tropomyosin model	S, T, U, V	protein	135	Sus scrofa

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>7TJ7_1 cardiac actin (chains A, B, C, D, E, F)
DDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMT
QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDL
AGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDEAGPSIVHRKCF

Sequence of entity 2 (G, H, I, J, K, L, M, N, O, P, Q, R), FASTA

>7TJ7_2 Myosin-binding protein C, cardiac-type (chains G, H, I, J, K, L, M, N, O, P, Q, R)
DDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLH
DSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSA
FRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPP
SEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLE

Sequence of entity 3 (S, T, U, V), FASTA

>7TJ7_3 tropomyosin model (chains S, T, U, V)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXX

Primary citation

Cryo-Electron Microscopy Reveals Cardiac Myosin Binding Protein-C M-Domain Interactions with the Thin Filament. Risi, C.M., Villanueva, E., Belknap, B. et al. J Mol Biol (2022) 434:167879-167879. DOI 10.1016/j.jmb.2022.167879 · PubMed

Other PDB entries of the same protein (UniProt P68137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CBW 2.5 Å, Crystal structure of Plasmodium berghei actin I with D-loop from muscle actin
8EFH 3.3 Å, Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in complex…
8DD0 3.5 Å, The structure of the native cardiac thin filament junction region
7KO5 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7KOR 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper troponin in Ca2+ bound…
5NOL 8.0 Å, Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Closed" state
7KO4 8.0 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7KON 8.1 Å, Structure of upper Tn Ca2+ free (rotated) and lower Tn Ca2+ bound cardiac native thin…
7KO7 8.3 Å, Structure of the native cardiac thin filament at pCa=5.8 having upper Tn in Ca2+ free…
5NOG 11.0 Å, Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Blocked" state

Browse structure collections

About this viewer

MolViewer shows 7TJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.