Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (22 mM KSeCN). Determined by X-ray diffraction at 1.39 Å resolution. Released 14 Sept 2022.
Explore 7TNE in 3D Show helices and sheets RCSB PDB PDBe
7TNE contains 16 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| α-helix | 15-28 | 14 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 46-49 | 4 | |
| α-helix | 57-64 | 8 | |
| α-helix | 67-69 | 3 | |
| α-helix | 72-75 | 4 | |
| β-strand | 77-78 | 2 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-87 | 4 | 1 |
| α-helix | 91-92 | 2 | |
| α-helix | 100-111 | 12 | |
| β-strand | 121-126 | 6 | 1 |
| α-helix | 133-140 | 8 | |
| β-strand | 146-151 | 6 | 1 |
| α-helix | 155-170 | 16 | |
| β-strand | 178-185 | 8 | 1 |
| α-helix | 192-203 | 12 | |
| β-strand | 207-211 | 5 | 1 |
| α-helix | 212-213 | 2 | |
| α-helix | 216-222 | 7 | |
| α-helix | 227-230 | 4 | |
| α-helix | 235-249 | 15 | |
| β-strand | 254 | 1 | 1 |
| α-helix | 261-270 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nitrogenase iron protein 1 | A | protein | 290 | Azotobacter vinelandii | P00459 (AlphaFold model) |
>7TNE_1 Nitrogenase iron protein 1 (chains A) MAMRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIME MAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDL DFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSGSVRL GGLICNSRNTDREDELIIALANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADE YRALARKVVDNKLLVIPNPITMDELEELLMEFGIMEVEDESIVGKTAEEV
| ID | Name | Formula | Copies |
|---|---|---|---|
| SF4 | Iron/sulfur cluster | Fe4 S4 | 1 |
| SFS | Fe4-Se4 cluster | Fe4 Se4 | 1 |
| MG | Magnesium ion | Mg | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Selenocyanate derived Se-incorporation into the Nitrogenase Fe protein cluster. Buscagan, T.M., Kaiser, J.T., Rees, D.C. Elife (2022) 11. DOI 10.7554/eLife.79311 · PubMed
Other PDB entries of the same protein (UniProt P00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7TNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.