7TPS: ALPN-202

Crystal structure of ALPN-202 (engineered CD80 vIgD) in complex with PD-L1. Determined by X-ray diffraction at 3.15 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,316
Mol. weight: 76.21 kDa
Ligands: NAG
Released: 16 Mar 2022

Explore 7TPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TPS contains 10 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	1
β-strand	46-48	3	2
α-helix	57-61	5
β-strand	62-68	7	1
β-strand	71-77	7	1
β-strand	80-83	4	1
β-strand	91-94	4	2
β-strand	100-103	4	2
α-helix	108-110	3
β-strand	112-121	10	1
β-strand	126-139	14	1

Chain B: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	3
β-strand	27-31	5	4
β-strand	36-41	6	3
α-helix	50-52	3
β-strand	54-59	6	4
β-strand	62-68	7	4
β-strand	71-73	3	4
α-helix	79-81	3
β-strand	85-88	4	3
α-helix	89-92	4
β-strand	96-101	6	3
α-helix	106-108	3
β-strand	110-117	8	4
β-strand	121-131	11	4
β-strand	138-145	8	5
β-strand	150-159	10	5
β-strand	164-168	5	6
β-strand	174-175	2	6
β-strand	178-183	6	5
β-strand	191-200	10	5
β-strand	206-213	8	6
β-strand	218-225	8	6

Chain C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	37-41	5	7
β-strand	46-48	3	8
β-strand	63-68	6	7
β-strand	71-76	6	7
β-strand	83	1	7
β-strand	91-94	4	8
β-strand	100-103	4	8
α-helix	108-110	3
β-strand	112-119	8	7
β-strand	128-139	12	7

Chain D: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	9
β-strand	27-30	4	4
β-strand	36-41	6	9
α-helix	50-52	3
β-strand	54-59	6	4
β-strand	62-68	7	4
β-strand	71-73	3	4
α-helix	79-81	3
β-strand	85-88	4	9
β-strand	96-101	6	9
α-helix	106-108	3
β-strand	110-117	8	4
β-strand	121-130	10	4
β-strand	138-145	8	10
β-strand	150-159	10	10
β-strand	163-168	6	11
β-strand	174-175	2	11
β-strand	178-183	6	10
β-strand	191-200	10	10
β-strand	206-213	8	11
β-strand	218-225	8	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-lymphocyte activation antigen CD80	A, C	protein	106	Homo sapiens	P33681 (AlphaFold model)
Programmed cell death 1 ligand 1	B	protein	209	Homo sapiens	Q9NZQ7 (AlphaFold model)
Programmed cell death 1 ligand 1	D	protein	209	Homo sapiens	Q9NZQ7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7TPS_1 T-lymphocyte activation antigen CD80 (chains A, C)
VIHVTKEVKEVATLSCGYNVSVEELEQTRIYWQKDKKMVLTMMSGDLNIWPEYKNRTIFD
ITNNLSIMILGLRPSDEGTYECVVLKYEKGAFKREHLAEVTLSVKA

Sequence of entity 2 (B), FASTA

>7TPS_2 Programmed cell death 1 ligand 1 (chains B)
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQH
SSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKIN
QRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLR
INTTTNEIFYCTFRRLDPEENHTAELVIP

Sequence of entity 3 (D), FASTA

>7TPS_3 Programmed cell death 1 ligand 1 (chains D)
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQH
SSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKIN
QRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLR
INTTTNEIFYCTFRRLDPEENHTAELVIP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Water and common crystallization additives (GOL) are not listed.

Primary citation

The engineered CD80 variant fusion therapeutic davoceticept combines checkpoint antagonism with conditional CD28 costimulation for anti-tumor immunity. Maurer, M.F., Lewis, K.E., Kuijper, J.L. et al. Nat Commun (2022) 13:1790-1790. DOI 10.1038/s41467-022-29286-5 · PubMed

Other PDB entries of the same protein (UniProt P33681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FXW 2.7 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring)
8FXZ 2.86 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (heptameric ring)
1DR9 3.0 Å, Crystal structure of a soluble form of B7-1 (CD80)
1I8L 3.0 Å, Human B7-1/CTLA-4 co-stimulatory complex
8HXA 3.04 Å, Cryo-EM structure of MPXV M2 in complex with human B7.1

Browse structure collections

About this viewer

MolViewer shows 7TPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.