7TQ9: Nitrogenase iron protein 1

Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (22 mM KSeCN, with Av1). Determined by X-ray diffraction at 1.6 Å resolution. Released 14 Sept 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Azotobacter vinelandii
Chains: 1
Atoms: 2,277
Mol. weight: 32.89 kDa
Ligands: MG, ADP, SFS, SF4
Released: 14 Sept 2022

Explore 7TQ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TQ9 contains 17 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
α-helix	15-28	14
β-strand	33-38	6	1
α-helix	46-49	4
α-helix	57-64	8
α-helix	67-69	3
α-helix	72-75	4
β-strand	77-78	2	1
α-helix	80-82	3
β-strand	84-87	4	1
α-helix	91-92	2
α-helix	100-111	12
β-strand	121-126	6	1
α-helix	133-135	3
α-helix	137-140	4
β-strand	146-151	6	1
α-helix	155-170	16
β-strand	178-185	8	1
α-helix	192-203	12
β-strand	207-211	5	1
α-helix	212-213	2
α-helix	216-222	7
α-helix	227-230	4
α-helix	235-249	15
β-strand	254	1	1
α-helix	261-270	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nitrogenase iron protein 1	A	protein	290	Azotobacter vinelandii	P00459 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TQ9_1 Nitrogenase iron protein 1 (chains A)
MAMRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHSKAQNTIME
MAAEAGTVEDLELEDVLKAGYGGVKCVESGGPEPGVGCAGRGVITAINFLEEEGAYEDDL
DFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYANSGSVRL
GGLICNSRNTDREDELIIALANKLGTQMIHFVPRDNVVQRAEIRRMTVIEYDPKAKQADE
YRALARKVVDNKLLVIPNPITMDELEELLMEFGIMEVEDESIVGKTAEEV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
SFS	Fe4-Se4 cluster	Fe4 Se4	1
SF4	Iron/sulfur cluster	Fe4 S4	1

Primary citation

Selenocyanate derived Se-incorporation into the Nitrogenase Fe protein cluster. Buscagan, T.M., Kaiser, J.T., Rees, D.C. Elife (2022) 11. DOI 10.7554/eLife.79311 · PubMed

Other PDB entries of the same protein (UniProt P00459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N4L 1.13 Å, Dithionite-reduced ADP-bound form of the nitrogenase Fe-protein from A. vinelandii
7TPW 1.18 Å, Selenium-free nitrogenase Fe protein (Av2) from A. vinelandii
7TPO 1.35 Å, Selenium-incorporated nitrogenase Fe-protein (Av2-Se) from A. vinelandii (1 mM KSeCN)
7TPX 1.35 Å, Selenium-free nitrogenase Fe protein (Av2) from A. vinelandii
7TPN 1.38 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (11 mM KSeCN)
7TNE 1.39 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (22 mM KSeCN)
7TQF 1.45 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (22 mM KSeCN)
7TQI 1.47 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (11 mM KSeCN)
7TPY 1.48 Å, Selenium-free nitrogenase Fe protein (Av2) from A. vinelandii (nucleotide control)
7TQJ 1.48 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (1 mM KSeCN)
7TQK 1.48 Å, Selenium-incorporated nitrogenase Fe protein (Av2-Se) from A. vinelandii (1 mM KSeCN)
7TPV 1.49 Å, Selenium-free nitrogenase Fe protein (Av2) from A. vinelandii (5mM KSeCN Soaked)

Browse structure collections

About this viewer

MolViewer shows 7TQ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.