7TRD: Human telomerase catalytic core structure

Human telomerase catalytic core structure at 3.3 Angstrom. Determined by electron microscopy at 3.3 Å resolution. Released 20 Apr 2022.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 12,240
Mol. weight: 281.7 kDa
Released: 20 Apr 2022

Explore 7TRD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TRD contains 48 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 48 helices, 36 β-strands

Element	Residues	Length	Sheet
α-helix	8-17	10
β-strand	21-23	3	1
α-helix	24-31	8
α-helix	45-53	9
β-strand	54-57	4	1
α-helix	63-65	3
α-helix	77-91	15
β-strand	101-103	3	2
β-strand	119-121	3	2
α-helix	126-133	8
α-helix	135-144	10
α-helix	147-155	9
β-strand	157-162	6	1
β-strand	166-171	6	1
α-helix	175-177	3
β-strand	325-327	3	3
α-helix	328-331	4
α-helix	346-349	4
α-helix	354-365	12
α-helix	379-383	5
α-helix	384-387	4
α-helix	390-400	11
α-helix	405-412	8
α-helix	447-453	7
β-strand	456	1	4
α-helix	458-470	13
α-helix	475-478	4
α-helix	481-495	15
β-strand	502-504	3	3
α-helix	505-508	4
α-helix	518-520	3
α-helix	531-547	17
α-helix	548-553	6
α-helix	554-560	7
β-strand	561-564	4	4
β-strand	574-577	4	4
α-helix	578-595	18
β-strand	598-600	3	5
α-helix	601-602	2
α-helix	603-611	9
β-strand	618-626	9	5
β-strand	629-636	8	5
α-helix	653-671	19
α-helix	673-676	4
β-strand	679	1	6
α-helix	683-697	15
α-helix	703-706	4
β-strand	707-713	7	6
α-helix	722-732	11
β-strand	738-739	2	7
β-strand	740-749	10	1
β-strand	755-764	10	1
α-helix	766-768	3
α-helix	773-783	11
β-strand	789-795	7	1
β-strand	800-801	2	7
α-helix	802-814	13
β-strand	817-820	4	5
β-strand	823-827	5	5
α-helix	838-853	16
β-strand	862-865	4	6
β-strand	869-874	6	6
α-helix	877-889	13
β-strand	891	1	8
β-strand	896	1	8
β-strand	898-905	8	6
β-strand	920-921	2	6
β-strand	927-930	4	9
β-strand	933-936	4	9
β-strand	942-944	3	9
α-helix	947-949	3
β-strand	953	1	10
α-helix	955-957	3
α-helix	966-981	16
α-helix	984-987	4
α-helix	994-1016	23
α-helix	1025-1027	3
α-helix	1029-1050	22
β-strand	1058	1	11
β-strand	1062	1	11
α-helix	1067-1081	15
α-helix	1086-1106	21
α-helix	1109-1118	10
β-strand	1131	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomerase RNA, partial sequence	B	RNA	451	Homo sapiens
Telomerase reverse transcriptase	A	protein	1167	Homo sapiens	O14746 (AlphaFold model)
Telomeric repeat substrate	N	DNA	18	Homo sapiens

Sequence of entity 1 (B), FASTA

>7TRD_1 Telomerase RNA, partial sequence (chains B)
GGGUUGCGGAGGGUGGGCCUGGGAGGGGUGGUGGCCAUUUUUUGUCUAACCCUAACUGAG
AAGGGCGUAGGCGCCGUGCUUUUGCUCCCCGCGCGCUGUUUUUCUCGCUGACUUUCAGCG
GGCGGAAAAGCCUCGGCCUGCCGCCUUCCACCGUUCAUUCUAGAGCAAACAAAAAAUGUC
AGCUGCUGGCCCGUUCGCCCCUCCCGGGGACCUGCGGCGGGUCGCCUGCCCAGCCCCCGA
ACCCCGCCUGGAGGCCGCGGUCGGCCCGGGGCUUCUCCGGAGGCACCCACUGCCACCGCG
AAGAGUUGGGCUCUGUCAGCCGCGGGUCUCUCGGGGGCGAGGGCGAGGUUCAGGCCUUUC
AGGCCGCAGGAAGAGGAACGGAGCGAGUCCCCGCGCGCGGCGCGAUUCCCUGAGCUGUGG
GACGUGCACCCAGGACUCGGCUCACACAUGC

Sequence of entity 2 (A), FASTA

>7TRD_2 Telomerase reverse transcriptase (chains A)
GHMSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKSAMPRAPRCRAVRSLLRSHYREVLPLA
TFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPWDARPPPAAPSFRQVSCLKELVARVL
QRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVRSYLPNTVTDALRGSGAWGLLLRRVG
DDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGAATQARPPPHASGPRRRLGCERAWNH
SVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRRGAAPEPERTPVGQGSWAHPGRTRGP
SDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVY
AETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQR
YWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDP
RRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLSL
QELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEILAKFLHWLMSVYVVELLRSFFYVTE
TTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRELSEAEVRQHREARPALLTSRLRFIP
KPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKALFSVLNYERARRPGLLGASVLGLDD
IHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTIPQDRLTEVIASIIKPQNTYCVRRYA
VVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHLQETSPLRDAVVIEQSSSLNEASSGL
FDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTLLCSLCYGDMENKLFAGIRRDGLLLR
LVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNLRKTVVNFPVEDEALGGTAFVQMPAH
GLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTFNRGFKAGRNMRRKLFGVLRLKCHSL
FLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYS
ILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSR
KLPGTTLTALEAAANPALPSDFKTILD

Sequence of entity 3 (N), FASTA

>7TRD_3 Telomeric repeat substrate (chains N)
TTTTTTTTTTTTTTAGGG

Primary citation

Structure of active human telomerase with telomere shelterin protein TPP1. Liu, B., He, Y., Wang, Y. et al. Nature (2022) 604:578-583. DOI 10.1038/s41586-022-04582-8 · PubMed

Other PDB entries of the same protein (UniProt O14746 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MEO 1.77 Å, Human Leukocyte Antigen presenting ILGKFLHRL
5MER 1.88 Å, Human Leukocyte Antigen A02 presenting ILAKFLHEL
5MEQ 2.27 Å, Human Leukocyte Antigen A02 presenting ILAKFLHTL
5UGW 2.31 Å, Structure of the human telomerase thumb domain
4B18 2.52 Å, The crystal structure of human Importin alpha 5 with TERT NLS peptide
9Q16 2.7 Å, Human telomerase catalytic core with shelterin protein TPP1, dGpNHpp and DNA primer…
5MEP 2.71 Å, Human Leukocyte Antigen A02 presenting ILGKFLHWL
4MNQ 2.74 Å, TCR-peptide specificity overrides affinity enhancing TCR-MHC interactions
2BCK 2.8 Å, Crystal Structure of HLA-A*2402 Complexed with a telomerase peptide
9Q12 2.8 Å, Human telomerase catalytic core with shelterin protein TPP1 and DNA primer ending in TTAG
5MEN 2.81 Å, Human Leukocyte Antigen A02 presenting ILAKFLHWL, in complex with cognate T-Cell Receptor
9Q10 2.9 Å, Human telomerase catalytic core with shelterin protein TPP1, dTpNHpp and DNA primer…

Browse structure collections

About this viewer

MolViewer shows 7TRD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.