7TTZ: Heterodimeric IgA Fc

Heterodimeric IgA Fc in complex with Staphylococcus aureus protein SSL7. Determined by X-ray diffraction at 2.35 Å resolution. Released 1 Feb 2023.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: Homo sapiens, Staphylococcus aureus
Chains: 4
Atoms: 6,512
Mol. weight: 96.21 kDa
Ligands: NAG, 1PG
Released: 1 Feb 2023

Explore 7TTZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TTZ contains 41 α-helices and 68 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	245-249	5	1
α-helix	250-252	3
α-helix	253-258	6
β-strand	264-271	8	1
β-strand	278-281	4	2
α-helix	288-289	2
β-strand	290-291	2	1
β-strand	302-308	7	1
α-helix	312-317	6
α-helix	319	1
β-strand	320-326	7	2
β-strand	334-339	6	2
β-strand	345	1	3
α-helix	346-347	2
β-strand	348-352	5	4
α-helix	353-355	3
α-helix	356-361	6
β-strand	364-374	11	4
β-strand	375	1	3
β-strand	380-385	6	5
β-strand	388-389	2	5
α-helix	390-391	2
α-helix	392-394	3
β-strand	395-397	3	4
α-helix	398-400	3
β-strand	401-402	2	4
α-helix	403-404	2
β-strand	411-420	10	4
α-helix	421-426	6
β-strand	430-435	6	5
β-strand	443-448	6	5

Chain B: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	245-249	5	6
α-helix	250-252	3
α-helix	253-258	6
β-strand	264-271	8	6
β-strand	278-282	5	7
α-helix	288-289	2
β-strand	290-291	2	6
α-helix	292-294	3
β-strand	295-296	2	6
β-strand	302-308	7	6
α-helix	312-317	6
α-helix	319-320	2
β-strand	321-326	6	7
β-strand	334-338	5	7
β-strand	345	1	8
α-helix	346-347	2
β-strand	348-352	5	9
α-helix	353-355	3
α-helix	356-360	5
β-strand	364-374	11	9
β-strand	375	1	8
β-strand	380-385	6	10
β-strand	388-389	2	10
α-helix	390-391	2
α-helix	392-394	3
β-strand	395-397	3	9
α-helix	398-400	3
β-strand	401-402	2	9
α-helix	403-404	2
β-strand	411-420	10	9
α-helix	421-426	6
β-strand	430-435	6	10
β-strand	443-448	6	10

Chain C: 7 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
β-strand	25-33	9	11
β-strand	34-37	4	12
β-strand	40-47	8	12
β-strand	50-56	7	12
α-helix	60-63	4
β-strand	67-75	9	11
β-strand	79-80	2	12
α-helix	85	1
β-strand	86-89	4	12
β-strand	92-93	2	11
β-strand	102-112	11	13
β-strand	115-125	11	13
β-strand	129-131	3	14
α-helix	132-147	16
β-strand	157-163	7	13
β-strand	168-172	5	13
α-helix	176-178	3
α-helix	179-181	3
β-strand	185-187	3	14
α-helix	188-190	3
β-strand	191-198	8	13

Chain D: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
β-strand	24-33	10	15
β-strand	35-37	3	16
β-strand	40-46	7	16
β-strand	51-56	6	16
α-helix	60-63	4
β-strand	67-76	10	15
β-strand	79-80	2	16
α-helix	85	1
β-strand	86-89	4	16
β-strand	92-93	2	15
β-strand	102-109	8	17
β-strand	119-125	7	17
β-strand	129-131	3	18
α-helix	132-146	15
β-strand	151	1	17
β-strand	154-163	10	17
β-strand	168-172	5	17
α-helix	176-178	3
α-helix	179-181	3
β-strand	185-187	3	18
α-helix	188-190	3
β-strand	191-200	10	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgA Fc	A	protein	220	Homo sapiens	Q6MZV6 (AlphaFold model)
IgA Fc	B	protein	220	Homo sapiens	Q6MZV6 (AlphaFold model)
Superantigen-like protein SSL7	C, D	protein	201	Staphylococcus aureus	A0A9Y2YA69 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TTZ_1 IgA Fc (chains A)
RVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGP
PERDLCGCYSVSSVLPGSAQPWNHGETFTCTAAHPELKTPLTATLSKSGNTFRPEVHLLP
PPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFFV
YSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAG

Sequence of entity 2 (B), FASTA

>7TTZ_2 IgA Fc (chains B)
RVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGP
PERDLCGCYSVSSVLPGSAQPWNHGETFTCTAAHPELKTPLTATLSKSGNTFRPEVHLLP
PPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYVTTASRQEPSQGTTTFAV
TSLLRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAG

Sequence of entity 3 (C, D), FASTA

>7TTZ_3 Superantigen-like protein SSL7 (chains C, D)
KEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQNHQLFLLGED
KAKYKQGLQGQDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNIHLLVNKLDGGNLDATN
DSFLINKEEVSLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNGGKKQEIDLGDKLQFE
RMGDVLNSKDINKIEVTLKQI

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
1PG	2-(2-{2-[2-(2-methoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethanol	C11 H24 O6	7

Water and common crystallization additives (GOL, EDO) are not listed.

Primary citation

Engineering a pure and stable heterodimeric IgA for the development of multispecific therapeutics. Heinkel, F., Verstraete, M.M., Cao, S. et al. MAbs (2022) 14:2141637-2141637. DOI 10.1080/19420862.2022.2141637 · PubMed

Other PDB entries of the same protein (UniProt Q6MZV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OV2 2.3 Å, Crystal structure of human IGA2M1 FC fragment-FC-alpha receptor (CD89) complex

Browse structure collections

About this viewer

MolViewer shows 7TTZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.