7TZH: Human LAG3 domains 3-4

Structure of human LAG3 domains 3-4 in complex with antibody single chain-variable fragment. Determined by X-ray diffraction at 2.43 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.43 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,101
Mol. weight: 92.02 kDa
Ligands: NAG
Released: 11 May 2022

Explore 7TZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TZH contains 21 α-helices and 82 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	10
β-strand	12-14	3	11
β-strand	20-27	8	10
α-helix	31-33	3
β-strand	36-41	6	11
β-strand	47-53	7	11
β-strand	60-62	3	11
α-helix	64-66	3
β-strand	70-75	6	10
β-strand	80-85	6	10
α-helix	90-92	3
β-strand	94-101	8	11
β-strand	106	1	12
β-strand	111-114	4	11
β-strand	118-122	5	11
α-helix	141-142	2
β-strand	143-145	3	13
β-strand	149-152	4	14
β-strand	158-164	7	13
β-strand	172-177	6	14
β-strand	184-188	5	14
β-strand	192-193	2	14
α-helix	194	1
β-strand	201-206	6	13
β-strand	209-214	6	13
α-helix	219-221	3
β-strand	224-229	6	14
β-strand	232	1	15
β-strand	237	1	14
β-strand	241-245	5	14
α-helix	246	1

Chain B: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	268-273	6	16
β-strand	278-280	3	17
β-strand	283	1	18
β-strand	295-299	5	16
α-helix	306	1
β-strand	307-310	4	16
β-strand	312	1	18
β-strand	315	1	18
β-strand	318-320	3	17
α-helix	325-327	3
β-strand	329-336	8	16
β-strand	341-360	20	16
β-strand	364-371	8	16
β-strand	379-384	6	19
β-strand	390	1	12
β-strand	392	1	15
β-strand	393-394	2	19
β-strand	397-401	5	16
α-helix	402-406	5
β-strand	410-416	7	19
β-strand	419-426	8	19

Chain C: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	12-13	2	2
β-strand	19-27	9	1
α-helix	31-33	3
β-strand	36-41	6	2
β-strand	47-53	7	2
α-helix	55-57	3
β-strand	60-62	3	2
β-strand	70-75	6	1
β-strand	80-86	7	1
α-helix	90-92	3
β-strand	94-101	8	2
β-strand	106	1	3
β-strand	111-114	4	2
β-strand	118-121	4	2
α-helix	141-142	2
β-strand	143-145	3	4
β-strand	149-152	4	5
β-strand	158-164	7	4
β-strand	172-177	6	5
β-strand	184-188	5	5
β-strand	192-193	2	5
α-helix	194	1
β-strand	201-206	6	4
β-strand	209-214	6	4
α-helix	219-221	3
β-strand	224-229	6	5
β-strand	232-233	2	6
α-helix	235	1
β-strand	237	1	5
β-strand	241-245	5	5
α-helix	246	1

Chain D: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	268-273	6	7
β-strand	278-280	3	8
β-strand	283	1	9
β-strand	294-299	6	7
α-helix	300	1
β-strand	307-311	5	7
β-strand	315	1	9
β-strand	318-320	3	8
α-helix	325-327	3
β-strand	329-336	8	7
β-strand	341-355	15	7
β-strand	367-371	5	7
β-strand	378-384	7	6
β-strand	390	1	3
β-strand	392-394	3	6
β-strand	397-398	2	7
α-helix	402-407	6
β-strand	410-416	7	6
β-strand	419-426	8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
scFvF7	A, C	protein	247	Homo sapiens
Lymphocyte activation gene 3 protein	B, D	protein	190	Homo sapiens	P18627 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7TZH_1 scFvF7 (chains A, C)
MAQVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSGISAGGTGT
YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDQDGGKKTDAFDIWGQGTMV
TVSSGGGGSGGGGSGGGGSDIVMTQSPSLLSASVGDRVTITCRASQGINYYLAWYQQKPG
KAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQTGYYPLTFGPG
TKVDIAA

Sequence of entity 2 (B, D), FASTA

>7TZH_2 Lymphocyte activation gene 3 protein (chains B, D)
GLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRL
EDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERF
VWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGR
APGALPAGHL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

LAG3 ectodomain structure reveals functional interfaces for ligand and antibody recognition. Ming, Q., Celias, D.P., Wu, C. et al. Nat Immunol (2022) 23:1031-1041. DOI 10.1038/s41590-022-01238-7 · PubMed

Other PDB entries of the same protein (UniProt P18627 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UM3 2.4 Å, Crystal structure of a Fab in complex with a peptide derived from the LAG-3 D1 domain…
9BF9 3.4 Å, Human LAG-3-HLA-DR1 complex
8SR0 3.53 Å, CryoEM structure of a therapeutic antibody (favezelimab) bound to human LAG3 local refined
8SO3 3.61 Å, CryoEM structure of a therapeutic antibody (favezelimab) bound to human LAG3
7TZG 3.71 Å, Structure of human LAG3 in complex with antibody single-chain variable fragment

Browse structure collections

About this viewer

MolViewer shows 7TZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.