recombinant Mambalgin-1. Determined by X-ray diffraction at 2.49 Å resolution. Released 3 May 2023.
Explore 7ULB in 3D Show helices and sheets RCSB PDB PDBe
7ULB contains 4 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 8-11 | 4 | 1 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 2 |
| β-strand | 30-38 | 9 | 2 |
| β-strand | 47-50 | 4 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 5 |
| β-strand | 8-11 | 4 | 5 |
| α-helix | 12-13 | 2 | |
| β-strand | 18-27 | 10 | 4 |
| β-strand | 30-38 | 9 | 4 |
| β-strand | 48-50 | 3 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mambalgin-1 | A, B, C, D | protein | 66 | Dendroaspis polylepis polylepis | P0DKR6 (AlphaFold model) |
>7ULB_1 Mambalgin-1 (chains A, B, C, D) MKREAEALKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTD RCNKGS
Structure of recombinant mambalgin at 2.49 Angstroms resolution. Xu, J., Lei, X., Chen, L. To be published.
Other PDB entries of the same protein (UniProt P0DKR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ULB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.