7ULB: Recombinant Mambalgin-1

recombinant Mambalgin-1. Determined by X-ray diffraction at 2.49 Å resolution. Released 3 May 2023.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Dendroaspis polylepis polylepis
Chains: 4
Atoms: 1,890
Mol. weight: 30.39 kDa
Released: 3 May 2023

Explore 7ULB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ULB contains 4 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	8-11	4	1
α-helix	12-13	2
β-strand	18-27	10	2
β-strand	30-38	9	2
β-strand	47-50	4	2

Chain C: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	5
β-strand	8-11	4	5
α-helix	12-13	2
β-strand	18-27	10	4
β-strand	30-38	9	4
β-strand	48-50	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mambalgin-1	A, B, C, D	protein	66	Dendroaspis polylepis polylepis	P0DKR6 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7ULB_1 Mambalgin-1 (chains A, B, C, D)
MKREAEALKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTD
RCNKGS

Primary citation

Structure of recombinant mambalgin at 2.49 Angstroms resolution. Xu, J., Lei, X., Chen, L. To be published.

Other PDB entries of the same protein (UniProt P0DKR6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DO6 1.7 Å, Crystal structure of Dendroaspis polylepis venom mambalgin-1 T23A mutant
5DU1 1.8 Å, Crystal structure of Dendroaspis polylepis mambalgin-1 wild-type in P21 space group.
5DZ5 1.95 Å, Crystal structure of Dendroaspis polylepis mambalgin-1 wild-type in P41212 space group
7CFT 3.9 Å, Cryo-EM strucutre of human acid-sensing ion channel 1a in complex with snake toxin…
2MJY Solution structure of synthetic Mamba-1 peptide

Browse structure collections

About this viewer

MolViewer shows 7ULB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.