7UOA: MAGEA4-MTP1 linear peptide complex

MAGEA4-MTP1 linear peptide complex. Determined by X-ray diffraction at 3.5 Å resolution. Released 7 Sept 2022.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,662
Mol. weight: 26.54 kDa
Released: 7 Sept 2022

Explore 7UOA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UOA contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	102-127	26
β-strand	130-132	3	1
α-helix	133-139	7
α-helix	145-147	3
α-helix	148-160	13
β-strand	165-169	5	1
β-strand	176-181	6	1
α-helix	200-212	13
β-strand	216-218	3	2
α-helix	219-228	10
β-strand	237	1	3
β-strand	241	1	3
α-helix	243-245	3
α-helix	246-250	5
α-helix	251-253	3
β-strand	257-260	4	2
β-strand	271-274	4	2
α-helix	276-281	6
α-helix	284-295	12
α-helix	297-300	4
α-helix	305-310	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Melanoma antigen A 4	A	protein	220	Homo sapiens	P43358 (AlphaFold model)
MTP-1	B	protein	10	synthetic construct

Sequence of entity 1 (A), FASTA

>7UOA_1 Melanoma antigen A 4 (chains A)
SNADAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASE
SLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSA
SEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPR
ALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV

Sequence of entity 2 (B), FASTA

>7UOA_2 MTP-1 (chains B)
YIRLYDYHNC

Primary citation

Discovery and Structural Basis of the Selectivity of Potent Cyclic Peptide Inhibitors of MAGE-A4. Fleming, M.C., Chiou, L.F., Tumbale, P.P. et al. J Med Chem (2022) 65:7231-7245. DOI 10.1021/acs.jmedchem.2c00185 · PubMed

Other PDB entries of the same protein (UniProt P43358 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TRN 1.35 Å, Crystal structure of HLA A2*01-AVYDGREHTV
1I4F 1.4 Å, Crystal structure of HLA-A*0201/MAGE-A4-peptide complex
33CG 2.2 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-6
33CI 2.2 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-58
2WA0 2.3 Å, Crystal structure of the human MAGEA4
33CH 2.4 Å, Cryo-EM structure of MAGE-A4 (230-239)-bound HLA-A*02:01 in complex with Fab VR-4
9BD3 2.58 Å, Structure of the MAGEA4 MHD-RAD18 R6BD Complex
8ES8 2.65 Å, CryoEM structure of PN45545 TCR-CD3 in complex with HLA-A2 MAGEA4 (230-239)
6TRO 3.0 Å, Crystal structure of the T-cell receptor GVY01 bound to HLA A2*01-GVYDGREHTV
8FJA 3.0 Å, CryoEM structure of HLA-A2 MAGEA4 (230-239) in complex with REGN6972 Fab
8ES9 3.25 Å, CryoEM structure of PN45428 TCR-CD3 in complex with HLA-A2 MAGEA4

Browse structure collections

About this viewer

MolViewer shows 7UOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.