MAGEA4-MTP1 linear peptide complex. Determined by X-ray diffraction at 3.5 Å resolution. Released 7 Sept 2022.
Explore 7UOA in 3D Show helices and sheets RCSB PDB PDBe
7UOA contains 13 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 102-127 | 26 | |
| β-strand | 130-132 | 3 | 1 |
| α-helix | 133-139 | 7 | |
| α-helix | 145-147 | 3 | |
| α-helix | 148-160 | 13 | |
| β-strand | 165-169 | 5 | 1 |
| β-strand | 176-181 | 6 | 1 |
| α-helix | 200-212 | 13 | |
| β-strand | 216-218 | 3 | 2 |
| α-helix | 219-228 | 10 | |
| β-strand | 237 | 1 | 3 |
| β-strand | 241 | 1 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 246-250 | 5 | |
| α-helix | 251-253 | 3 | |
| β-strand | 257-260 | 4 | 2 |
| β-strand | 271-274 | 4 | 2 |
| α-helix | 276-281 | 6 | |
| α-helix | 284-295 | 12 | |
| α-helix | 297-300 | 4 | |
| α-helix | 305-310 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Melanoma antigen A 4 | A | protein | 220 | Homo sapiens | P43358 (AlphaFold model) |
| MTP-1 | B | protein | 10 | synthetic construct |
>7UOA_1 Melanoma antigen A 4 (chains A) SNADAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASE SLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSA SEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPR ALAETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV
>7UOA_2 MTP-1 (chains B) YIRLYDYHNC
Discovery and Structural Basis of the Selectivity of Potent Cyclic Peptide Inhibitors of MAGE-A4. Fleming, M.C., Chiou, L.F., Tumbale, P.P. et al. J Med Chem (2022) 65:7231-7245. DOI 10.1021/acs.jmedchem.2c00185 · PubMed
Other PDB entries of the same protein (UniProt P43358 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7UOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.